Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi3g1v0204500.1

Overview

Field Value
Gene ID LotjaGi3g1v0204500
Transcript ID LotjaGi3g1v0204500.1
Lotus japonicus genome version Gifu v1.2
Description Protein transport protein Sec61 subunit beta; TAIR: AT3G60540.1 Preprotein translocase Sec, Sec61-beta subunit protein; Swiss-Prot: sp|P38389|SC61B_ARATH Protein transport protein Sec61 subunit beta; TrEMBL-Plants: tr|I3SVM8|I3SVM8_LOTJA Uncharacterized protein; Found in the gene: LotjaGi3g1v0204500
Working Lj name n.a.

Sequence information

Genomic sequence (LjG1.1_chr3:29973672..29973920) extracted from Lotus japonicus Gifu genome v1.2.

ATGGCTTTAGGTGGAGGAAACCCCCAAAGAGGAAGTGCTGCAGCTACTGCAAGCATGAGGAGAAGGAAACCAGCTGGTGG TGCGGCCGCGGGAGGAGCAGCCGGGAACATGCTTCAATTTTACACTGATGATGCCCCTGGACTCAAGATCTCCCCAAATG TGGTTCTTGTAATGAGCATTGGCTTTATAGCATTTGTTGCCATTCTTCATGTGATGGGCAAGCTATATTTTGTGCGTAGG GAGGCATAG 

CDS sequence (LotjaGi3g1v0204500.1) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGGCTTTAGGTGGAGGAAACCCCCAAAGAGGAAGTGCTGCAGCTACTGCAAGCATGAGGAGAAGGAAACCAGCTGGTGG TGCGGCCGCGGGAGGAGCAGCCGGGAACATGCTTCAATTTTACACTGATGATGCCCCTGGACTCAAGATCTCCCCAAATG TGGTTCTTGTAATGAGCATTGGCTTTATAGCATTTGTTGCCATTCTTCATGTGATGGGCAAGCTATATTTTGTGCGTAGG GAGGCATAG 

Protein sequence (LotjaGi3g1v0204500.1) extracted from Lotus japonicus Gifu v1.2 Proteins.

MALGGGNPQRGSAAATASMRRRKPAGGAAAGGAAGNMLQFYTDDAPGLKISPNVVLVMSIGFIAFVAILHVMGKLYFVRR EA 

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Merging data from EBeye. Please wait…

Domains

Sorting

Prediction algorithm Identifier Start End Length E-value InterPro ID
PANTHER 1 82 82 2.1E-45
Phobius 1 53 53 -
MobiDBLite 1 32 32 -
PANTHER 1 82 82 2.1E-45
PIRSF 2 80 79 3.0E-26
TMHMM 24 41 18 -
Pfam 34 73 40 2.2E-18
Phobius 54 77 24 -
TMHMM 56 78 23 -
Phobius 78 82 5 -

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .

GO term Namespace Name Definition Relationships
Cellular component Sec61 translocon complex A translocon complex that contains a core heterotrimer of conserved alpha, beta and gamma subunits, and may contain additional proteins (translocon-associated proteins or TRAPs); in budding yeast the core proteins are Sec61p, Sbh1p, and Sss1p. The Sec61 translocon complex functions in cotranslational and posttranslational translocation events.
Biological process Intracellular protein transport The directed movement of proteins in a cell, including the movement of proteins between specific compartments or structures within a cell, such as organelles of a eukaryotic cell.

Expression data

Expression pattern

Expression pattern of LotjaGi3g1v0204500.1, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…