Transcript — View — Lotus Base

Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi3g1v0222300.1

Overview

Field	Value
Gene ID	LotjaGi3g1v0222300
Transcript ID	LotjaGi3g1v0222300.1
Lotus japonicus genome version	Gifu v1.2
Description	Protein VAC14 like; TAIR: AT2G01690.1 ARM repeat superfamily protein; Swiss-Prot: sp\|Q9ZU97\|VAC14_ARATH Protein VAC14 homolog; TrEMBL-Plants: tr\|A0A067L1Z3\|A0A067L1Z3_JATCU Uncharacterized protein; Found in the gene: LotjaGi3g1v0222300
Working Lj name	n.a.

Genomic sequence (LjG1.1_chr3:33602715..33604161) extracted from Lotus japonicus Gifu genome v1.2.

GAATGGCTGAAATTCTGGTACAGAGGGCAGGCTCTCCAGATGAATTTACTAGGCGAACAACTATTGCATGGGTAAGTGGT ACTATAATTCTCTGACTTAATAACCCAATATTTACTGTTACAATACCCTATACTTTAGTTTTGGCATTTTCGCAAAGCTA TTATTGCTTTTTATATCAAAAGAAATATTATTGGTTATTGATTTGTGATTCACTTGCATTTTATATAATTTATGTATGTG CTTTTTTATTTGTTCAGATAAATGAGTTTGTCAAACTTGGTGGAGACCAGTTTTGTCCATATTATGCTGACATTGTTGGA GCCATTTTACCTTGTATATCCGATAAAGAAGAGAAAATTAGAGTTGTAAGTTCACTTGAACTTTCCTTGTTTTCTTTCTT CGTTTTTCATCCCTTTTTTGCCCTTTATTCAATTACATTGCTCCTTGCCATGTATACCAACAAGTTTGAAGTTATCTTTG GCATATGTTCAAGCTTGCTCGTGAAACCAATGAAGAGCTACGCACCATCAAGGTTGATCCATCTGAAGGGTTTGATGTAG GAGCAATTCTCTCCATTTCCAGGAGGTGTGGTTTTTCTAACCTGATAAAAGAGGCTAGGAGTAGGTTTTAATTTTGTAAG ACATGCAATTGAAATATTATGGATTTGTGTAGTGGCTACTTCATCACTTTAGAAACTTTTGTTTCACTAGCATGTGCACA GCCAACATCTCCCAACCTCAAATATGAAAGTTATTTAAAGATTTGGGTGCAGAATGTGCGAGCGGAGCGGGGATGTGCTC TGTAAGTTCTAATGAAGTCAAAAAACTTCTTTCTTATAAGCTTTCTCTTTTGAATGACATGATTTTAACAATACATCTTC ATTTCACTTTGATGAAGGCGTTTCAGTGTGGTACTGGCTGTCTATGTCTTACTTAATTATTTTCTTAATTAGATTAGGAG TCTACTATTTGTATAAATAATGGCTAGTGCTTAGTCTTTAGTCTTTTGTATAATATCAAACCATAATCACAATTCAGTTC TTATCATTTATTCCCGCCTTTATCATGCAGTTGAGTGCTCTTTTAACCCACTTCTAAACAAAGGATCTATTACCAATTTG AACTTTTAAGGGTATACAAGAATTTTGATATCTAGAAAACGCCACAGCCTAGCTTTGAGAAACATTACATTTTGTATGTC CTTCAACCAATGCATATGTTATGCTTTGATTTAAAGTGGAAAATTGAGTTGACTCATATTGTAGGATGAGAATTTTTTCC CCTGTACTGAGAAATTGTTTGAAAGACTTGAACTATGAACTTCTACTCAAGTTTTCATTAACACTTCATTTGCATTTTCA GATACTCCAAAAACCCTTCGGTGGAGTCCTACTGAGAAGAATCAAAGTAAGGTCTTCCTTTCTTTAAACAACATCCTTCT AAAAAAA

Download Genomic Sequence

CDS sequence (LotjaGi3g1v0222300.1) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGGCTGAAATTCTGGTACAGAGGGCAGGCTCTCCAGATGAATTTACTAGGCGAACAACTATTGCATGGATAAATGAGTT TGTCAAACTTGGTGGAGACCAGTTTTGTCCATATTATGCTGACATTGTTGGAGCCATTTTACCTTGTATATCCGATAAAG AAGAGAAAATTAGAGTTCTTGCTCGTGAAACCAATGAAGAGCTACGCACCATCAAGGTTGATCCATCTGAAGGGTTTGAT GTAGGAGCAATTCTCTCCATTTCCAGGAGCATGTGCACAGCCAACATCTCCCAACCTCAAATATGA

Download CDS Sequence

Protein sequence (LotjaGi3g1v0222300.1) extracted from Lotus japonicus Gifu v1.2 Proteins.

MAEILVQRAGSPDEFTRRTTIAWINEFVKLGGDQFCPYYADIVGAILPCISDKEEKIRVLARETNEELRTIKVDPSEGFD VGAILSISRSMCTANISQPQI

Download Protein Sequence

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Prediction algorithm	Identifier	Start	End	Length	E-value	InterPro ID
PANTHER	PTHR16023:SF2 View details on PTHR16023:SF2 Search for proteins/transripts with this domain View external data on PTHR16023:SF2	1	94	94	3.0E-51	–
PANTHER	PTHR16023 View details on PTHR16023 Search for proteins/transripts with this domain View external data on PTHR16023	1	94	94	3.0E-51	IPR026825 Show description in modal box View details on IPR026825 Search for proteins/transripts with this domain View on EBI InterPro Service
SUPERFAMILY	SSF48371 View details on SSF48371 Search for proteins/transripts with this domain View external data on SSF48371	3	68	66	1.27E-6	IPR016024 Show description in modal box View details on IPR016024 Search for proteins/transripts with this domain View on EBI InterPro Service

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on April 27, 2020, while the GO metadata was last updated on April 27, 2020.

GO term	Namespace	Name	Definition	Relationships
GO:0006661 View details of GO:0006661 AmiGO InterPro QuickGO	Biological process	Phosphatidylinositol biosynthetic process	The chemical reactions and pathways resulting in the formation of phosphatidylinositol, any glycophospholipid in which the sn-glycerol 3-phosphate residue is esterified to the 1-hydroxyl group of 1D-myo-inositol.	Subterm of View details of GO:0046474 View details of GO:0046488
GO:0070772 View details of GO:0070772 AmiGO InterPro QuickGO	Cellular component	PAS complex	A class III phosphatidylinositol 3-kinase complex that contains a phosphatidylinositol-3-phosphate 5-kinase subunit (Fab1p in yeast; PIKfyve in mammals), a kinase activator, and a phosphatase, and may also contain additional proteins; it is involved in regulating the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate. In mammals the complex is composed of PIKFYVE, FIG4 and VAC14. In yeast it is composed of Atg18p, Fig4p, Fab1p, Vac14p and Vac7p.	Subterm of View details of GO:0035032 View details of GO:0044437 Part of View details of GO:0005774

Genome browser

Expression data

Expression pattern

Expression pattern of LotjaGi3g1v0222300.1, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…