Transcript — View — Lotus Base

Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi4g1v0340900.1

Overview

Field	Value
Gene ID	LotjaGi4g1v0340900
Transcript ID	LotjaGi4g1v0340900.1
Lotus japonicus genome version	Gifu v1.2
Description	Zinc finger homeodomain protein; TAIR: AT5G42780.1 homeobox protein 27; Swiss-Prot: sp\|Q9FKJ9\|ZHD12_ARATH Zinc-finger homeodomain protein 12; TrEMBL-Plants: tr\|A0A0L9VGB3\|A0A0L9VGB3_PHAAN Uncharacterized protein; Found in the gene: LotjaGi4g1v0340900
Working Lj name	n.a.

Genomic sequence (LjG1.1_chr4:72094236..72095079) extracted from Lotus japonicus Gifu genome v1.2.

CTAATCTTTCAATCCTACATCTTAGTGTCATAAAAAACCATGTCTGATGCTGAGATCAATTTTCCTCCACCAGGTTTTGA GCAAGAAGTGGTGTACCTAGAGTGCAAACGCAACCATGCTGCATCACTAAACCGTGTTTGCTATGATGGATGTCAAGAGT TTCTCAAAGCAAGTGTTGATGAAAGCAACACCAAAGATGCTATGCTATGTGCTGTTTGTGGGTGTCATCAGAACTTTCAT CTCCAACATACTATGTACACCCCTAAAGCCCAGAGCCAAACAAGGAACACTCCGAACATTGGAAGTTCACTTGTAGGCCC ATCTGATCCTCATGTGGAATTTAGGGTGAGTGCCGAAAATAACCCTGAGAATGAGAGGATAGTGATGCTGCCAAAGCCAA AGAGGAAGAAGAGAACGACTTTCACGGTGCACTTGAGGAATCGAATGACAGAATTCGCTAATAGGATAGGGTGGACACCT AAAGGAACTAAAAGGGAGGAAATTGACAATTTTTGCTTAGATATTGGAATTAGTCATACAACATTCTTAGTGTGGTTGAG CAATCACCGTCCTCGAGCAATGAAGAAAAATACAGAAATGGCAAATTGAAAAGCTGAAAGTCAATCATCATACATCATCC TTGGAAGTTGGCATTCGAATTTTTTCCTTAAGGAGTCTAGTTTTGTTGTAAGTGCGAAAGACAATTTTAATTTATGGTGT GTTAGGGTTTCAGTTGTCTGCTTCTCAGTTTTCGTCTTTGTTATCGGTGTTAAGTTTTAATCTATCTTGAGTAATTTTAA TTTATAGTGTGTTAGGGTTTTTGTTGTCTGGTTCTCAGTTTTCG

Download Genomic Sequence

CDS sequence (LotjaGi4g1v0340900.1) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGTCTGATGCTGAGATCAATTTTCCTCCACCAGGTTTTGAGCAAGAAGTGGTGTACCTAGAGTGCAAACGCAACCATGC TGCATCACTAAACCGTGTTTGCTATGATGGATGTCAAGAGTTTCTCAAAGCAAGTGTTGATGAAAGCAACACCAAAGATG CTATGCTATGTGCTGTTTGTGGGTGTCATCAGAACTTTCATCTCCAACATACTATGTACACCCCTAAAGCCCAGAGCCAA ACAAGGAACACTCCGAACATTGGAAGTTCACTTGTAGGCCCATCTGATCCTCATGTGGAATTTAGGGTGAGTGCCGAAAA TAACCCTGAGAATGAGAGGATAGTGATGCTGCCAAAGCCAAAGAGGAAGAAGAGAACGACTTTCACGGTGCACTTGAGGA ATCGAATGACAGAATTCGCTAATAGGATAGGGTGGACACCTAAAGGAACTAAAAGGGAGGAAATTGACAATTTTTGCTTA GATATTGGAATTAGTCATACAACATTCTTAGTGTGGTTGAGCAATCACCGTCCTCGAGCAATGAAGAAAAATACAGAAAT GGCAAATTGA

Download CDS Sequence

Protein sequence (LotjaGi4g1v0340900.1) extracted from Lotus japonicus Gifu v1.2 Proteins.

MSDAEINFPPPGFEQEVVYLECKRNHAASLNRVCYDGCQEFLKASVDESNTKDAMLCAVCGCHQNFHLQHTMYTPKAQSQ TRNTPNIGSSLVGPSDPHVEFRVSAENNPENERIVMLPKPKRKKRTTFTVHLRNRMTEFANRIGWTPKGTKREEIDNFCL DIGISHTTFLVWLSNHRPRAMKKNTEMAN

Download Protein Sequence

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Prediction algorithm	Identifier	Start	End	Length	E-value	InterPro ID
PANTHER	PTHR31948:SF66 View details on PTHR31948:SF66 Search for proteins/transripts with this domain View external data on PTHR31948:SF66	16	180	165	3.8E-41	–
PANTHER	PTHR31948 View details on PTHR31948 Search for proteins/transripts with this domain View external data on PTHR31948	16	180	165	3.8E-41	–
Pfam	PF04770 View details on PF04770 Search for proteins/transripts with this domain View external data on PF04770	17	70	54	1.0E-17	IPR006456 Show description in modal box View details on IPR006456 Search for proteins/transripts with this domain View on EBI InterPro Service
ProSiteProfiles	PS51523 View details on PS51523 Search for proteins/transripts with this domain View external data on PS51523	19	70	52	18.509	IPR006456 Show description in modal box View details on IPR006456 Search for proteins/transripts with this domain View on EBI InterPro Service
TIGRFAM	TIGR01566 View details on TIGR01566 Search for proteins/transripts with this domain View external data on TIGR01566	19	68	50	1.6E-16	IPR006456 Show description in modal box View details on IPR006456 Search for proteins/transripts with this domain View on EBI InterPro Service
MobiDBLite	mobidb-lite View details on mobidb-lite Search for proteins/transripts with this domain	76	95	20	-	–
MobiDBLite	mobidb-lite View details on mobidb-lite Search for proteins/transripts with this domain	76	91	16	-	–
Gene3D	G3DSA:1.10.10.60 View details on G3DSA:1.10.10.60 Search for proteins/transripts with this domain View external data on G3DSA:1.10.10.60	104	182	79	2.9E-15	–
SUPERFAMILY	SSF46689 View details on SSF46689 Search for proteins/transripts with this domain View external data on SSF46689	116	182	67	3.33E-9	IPR009057 Show description in modal box View details on IPR009057 Search for proteins/transripts with this domain View on EBI InterPro Service
TIGRFAM	TIGR01565 View details on TIGR01565 Search for proteins/transripts with this domain View external data on TIGR01565	121	177	57	1.2E-16	IPR006455 Show description in modal box View details on IPR006455 Search for proteins/transripts with this domain View on EBI InterPro Service

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on April 27, 2020, while the GO metadata was last updated on April 27, 2020.

GO term	Namespace	Name	Definition	Relationships
GO:0003677 View details of GO:0003677 AmiGO InterPro QuickGO	Molecular function	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).	Subterm of View details of GO:0003676

Genome browser

Expression data

Expression pattern

Expression pattern of LotjaGi4g1v0340900.1, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…