Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
Field | Value |
---|---|
Gene ID | LotjaGi5g1v0038000 |
Transcript ID | LotjaGi5g1v0038000.1 |
Lotus japonicus genome version | Gifu v1.2 |
Description | Non-specific lipid-transfer protein; TAIR: AT3G51590.1 lipid transfer protein 12; Swiss-Prot: sp|P82007|NLTP1_HELAN Non-specific lipid-transfer protein AP10; TrEMBL-Plants: tr|G7IXE1|G7IXE1_MEDTR Lipid transfer protein; Found in the gene: LotjaGi5g1v0038000 |
Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr5:6341893..6342443) extracted from Lotus japonicus Gifu genome v1.2.
CACATATCTACTAACCAAGATGCCTGGAAGGAAAATGATGTCTTTTTTCATTCCTGTTATGACATTTGGGATAATGTTAA CCTCTTTCGTTTCAAGCCAGACGGATGAAATCTCTTGCTTTGCTGCCATACCGTATTTGGCACCGTGTCTACCATATCTC ACAGGTTTTGGGCAACCATCGTCTTATTGCTGCGTAGGAGCAACCACTTTAGCTCAAAGAGCTGACACCACTCAAAATCG CAGGGATCTATGTGGTTGTTTGAAAAAAGCTTCTGCACAATTTAATGTGAATGCCGACAAAGCGAAACAGCTCCCGCAAC TCTGTAACATCTCTCTTCCGTTCTCTTTTGATCCTAGTATTGATTGCAACACGTAAGTCTCTCTTTTCCTTGTGAACATG TACATGCTTATTTCACTCTGTTCATGTTTTATCGATTTTGTGCAGGATTCCTTGATGATTTTACACGGTTTGGTGGAAAA AGTTCGAAAGAAATAATAGGTGAAAAAGATAAAGACTATACACTTACGGATCTGCAAAGGGGAAATGTAGA
CDS sequence (LotjaGi5g1v0038000.1) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGCCTGGAAGGAAAATGATGTCTTTTTTCATTCCTGTTATGACATTTGGGATAATGTTAACCTCTTTCGTTTCAAGCCA GACGGATGAAATCTCTTGCTTTGCTGCCATACCGTATTTGGCACCGTGTCTACCATATCTCACAGGTTTTGGGCAACCAT CGTCTTATTGCTGCGTAGGAGCAACCACTTTAGCTCAAAGAGCTGACACCACTCAAAATCGCAGGGATCTATGTGGTTGT TTGAAAAAAGCTTCTGCACAATTTAATGTGAATGCCGACAAAGCGAAACAGCTCCCGCAACTCTGTAACATCTCTCTTCC GTTCTCTTTTGATCCTAGTATTGATTGCAACACGATTCCTTGA
Protein sequence (LotjaGi5g1v0038000.1) extracted from Lotus japonicus Gifu v1.2 Proteins.
MPGRKMMSFFIPVMTFGIMLTSFVSSQTDEISCFAAIPYLAPCLPYLTGFGQPSSYCCVGATTLAQRADTTQNRRDLCGC LKKASAQFNVNADKAKQLPQLCNISLPFSFDPSIDCNTIP
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
---|---|---|---|---|---|---|
PANTHER | 1 | 119 | 119 | 4.8E-39 | – | |
Phobius | 1 | 26 | 26 | - | – | |
PANTHER | 1 | 119 | 119 | 4.8E-39 | – | |
SignalP_GRAM_NEGATIVE | 1 | 26 | 26 | - | – | |
SignalP_GRAM_POSITIVE | 1 | 26 | 26 | - | – | |
Phobius | 1 | 9 | 9 | - | – | |
SignalP_EUK | 1 | 26 | 26 | - | – | |
Phobius | 10 | 21 | 12 | - | – | |
Phobius | 22 | 26 | 5 | - | – | |
Pfam | 25 | 107 | 83 | 9.2E-6 | ||
Phobius | 27 | 120 | 94 | - | – | |
Gene3D | 30 | 120 | 91 | 4.2E-26 | – | |
SUPERFAMILY | 31 | 119 | 89 | 1.7E-21 | ||
CDD | 31 | 117 | 87 | 6.8539E-26 | – | |
PRINTS | 32 | 48 | 17 | 2.2E-16 | ||
PRINTS | 52 | 66 | 15 | 2.2E-16 | ||
PRINTS | 73 | 88 | 16 | 2.2E-16 | ||
PRINTS | 89 | 106 | 18 | 2.2E-16 | ||
ProSitePatterns | 98 | 119 | 22 | - | ||
PRINTS | 107 | 118 | 12 | 2.2E-16 |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
GO term | Namespace | Name | Definition | Relationships |
---|---|---|---|---|
Biological process | Lipid transport | The directed movement of lipids into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Lipids are compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. | ||
Molecular function | Lipid binding | Interacting selectively and non-covalently with a lipid. |
Expression pattern of LotjaGi5g1v0038000.1, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…