Transcript — View — Lotus Base

Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi5g1v0098100.2

Overview

Field	Value
Gene ID	LotjaGi5g1v0098100
Transcript ID	LotjaGi5g1v0098100.2
Related isoforms 1	LotjaGi5g1v0098100.1
Lotus japonicus genome version	Gifu v1.2
Description	Pectinesterase; TAIR: AT3G10710.1 root hair specific 12; Swiss-Prot: sp\|Q9SG77\|PME24_ARATH Putative pectinesterase/pectinesterase inhibitor 24; TrEMBL-Plants: tr\|I1KFM7\|I1KFM7_SOYBN Pectinesterase; Found in the gene: LotjaGi5g1v0098100
Working Lj name	n.a.

Genomic sequence (LjG1.1_chr5:17542061..17542705) extracted from Lotus japonicus Gifu genome v1.2.

ATGGGTTTTCGCAATACAGCTGGTCCTCAAAAGCACCAAGCAGTAGCACTGATGACAAGTGCTGATCAAGCAGTTTTCTA CAAGTGTCACATTGATGCATATCAGGACACACTCTATGTTCATGCCAATCGTCAATTCTATAGAGAATGCTACATTTATG GCACAGTGGACTTCATTTTTGGAAATTCAGCAGCAGTGATCCAAAACTGCAACATTTTGCCAAAGGTACCAATGCATGGG CAGCAGATCACAATCACAGCACAAGGCAAAACTGACCCTAACATGAACACAGGAATCTCAATTCAGTATTGCAATATTGC ACCCTTTGGGAACTTGAGTTCTGTCCAAACTTACCTAGGAAGACCCTGGAAGAATTACTCAACCACAGTTTACGTAAGGT CCAGAATGGACAGCTTTGTTAACCCAAAGGGATGGTTACCATGGGTAGGGAACTCAGCACCAGACACCATCTTTTATTCA GAATTTCGGAATGTTGGACCAGGTGCTTCAACAAAGAATAGAGTGAAGTGGAAGGGTTTGAGAACCATTACTAGTAAACA AGCCAGCAAGTTTTCAATCAAGTCTTTTCTTCAAGGAGATAGATGGATTCCTTCATCAGGTGCCCCTTTTAAGTCTGATC TGTGA

Download Genomic Sequence

CDS sequence (LotjaGi5g1v0098100.2) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGGGTTTTCGCAATACAGCTGGTCCTCAAAAGCACCAAGCAGTAGCACTGATGACAAGTGCTGATCAAGCAGTTTTCTA CAAGTGTCACATTGATGCATATCAGGACACACTCTATGTTCATGCCAATCGTCAATTCTATAGAGAATGCTACATTTATG GCACAGTGGACTTCATTTTTGGAAATTCAGCAGCAGTGATCCAAAACTGCAACATTTTGCCAAAGGTACCAATGCATGGG CAGCAGATCACAATCACAGCACAAGGCAAAACTGACCCTAACATGAACACAGGAATCTCAATTCAGTATTGCAATATTGC ACCCTTTGGGAACTTGAGTTCTGTCCAAACTTACCTAGGAAGACCCTGGAAGAATTACTCAACCACAGTTTACGTAAGGT CCAGAATGGACAGCTTTGTTAACCCAAAGGGATGGTTACCATGGGTAGGGAACTCAGCACCAGACACCATCTTTTATTCA GAATTTCGGAATGTTGGACCAGGTGCTTCAACAAAGAATAGAGTGAAGTGGAAGGGTTTGAGAACCATTACTAGTAAACA AGCCAGCAAGTTTTCAATCAAGTCTTTTCTTCAAGGAGATAGATGGATTCCTTCATCAGGTGCCCCTTTTAAGTCTGATC TGTGA

Download CDS Sequence

Protein sequence (LotjaGi5g1v0098100.2) extracted from Lotus japonicus Gifu v1.2 Proteins.

MGFRNTAGPQKHQAVALMTSADQAVFYKCHIDAYQDTLYVHANRQFYRECYIYGTVDFIFGNSAAVIQNCNILPKVPMHG QQITITAQGKTDPNMNTGISIQYCNIAPFGNLSSVQTYLGRPWKNYSTTVYVRSRMDSFVNPKGWLPWVGNSAPDTIFYS EFRNVGPGASTKNRVKWKGLRTITSKQASKFSIKSFLQGDRWIPSSGAPFKSDL

Download Protein Sequence

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Prediction algorithm	Identifier	Start	End	Length	E-value	InterPro ID
PANTHER	PTHR31707:SF145 View details on PTHR31707:SF145 Search for proteins/transripts with this domain View external data on PTHR31707:SF145	1	213	213	2.8E-146	–
PANTHER	PTHR31707 View details on PTHR31707 Search for proteins/transripts with this domain View external data on PTHR31707	1	213	213	2.8E-146	–
Pfam	PF01095 View details on PF01095 Search for proteins/transripts with this domain View external data on PF01095	1	200	200	1.3E-95	IPR000070 Show description in modal box View details on IPR000070 Search for proteins/transripts with this domain View on EBI InterPro Service
Gene3D	G3DSA:2.160.20.10 View details on G3DSA:2.160.20.10 Search for proteins/transripts with this domain View external data on G3DSA:2.160.20.10	1	214	214	2.2E-85	IPR012334 Show description in modal box View details on IPR012334 Search for proteins/transripts with this domain View on EBI InterPro Service
SUPERFAMILY	SSF51126 View details on SSF51126 Search for proteins/transripts with this domain View external data on SSF51126	2	211	210	2.83E-67	IPR011050 Show description in modal box View details on IPR011050 Search for proteins/transripts with this domain View on EBI InterPro Service
ProSitePatterns	PS00503 View details on PS00503 Search for proteins/transripts with this domain View external data on PS00503	52	61	10	-	IPR033131 Show description in modal box View details on IPR033131 Search for proteins/transripts with this domain View on EBI InterPro Service

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on April 27, 2020, while the GO metadata was last updated on April 27, 2020.

GO term	Namespace	Name	Definition	Relationships
GO:0030599 View details of GO:0030599 AmiGO InterPro QuickGO	Molecular function	Pectinesterase activity	Catalysis of the reaction: pectin + n H2O = n methanol + pectate.	Subterm of View details of GO:0052689
GO:0042545 View details of GO:0042545 AmiGO InterPro QuickGO	Biological process	Cell wall modification	The series of events leading to chemical and structural alterations of an existing cell wall that can result in loosening, increased extensibility or disassembly.	Subterm of View details of GO:0071555

Genome browser

Expression data

Expression pattern

Expression pattern of LotjaGi5g1v0098100.2, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…