Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
Field | Value |
---|---|
Gene ID | LotjaGi5g1v0180400 |
Transcript ID | LotjaGi5g1v0180400.1 |
Lotus japonicus genome version | Gifu v1.2 |
Description | Ethylene-responsive transcription factor; TAIR: AT3G23230.1 Integrase-type DNA-binding superfamily protein; Swiss-Prot: sp|Q9LTC5|ERF98_ARATH Ethylene-responsive transcription factor ERF098; TrEMBL-Plants: tr|C6T1T9|C6T1T9_SOYBN Putative uncharacterized protein; Found in the gene: LotjaGi5g1v0180400 |
Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr5:45950429..45951316) extracted from Lotus japonicus Gifu genome v1.2.
CTCAACTTTCTAGCAAGCTCAATTAAGCTTCTTCAGAATAAAGCAAAACAAAGACACTTGTTGTATTGTAACACAATAAA ATATATTGTTCTTCTCTTCTTCTAATTCTTGTTTGCATAGTGTTTCGAGTTATATTAATATTTGATTCTATAGCACAACA ATGGAGGCAGAGAGACCATCAGGTTCCAATGGAAACAACAATGGGGAGGTTCGTTACAGAGGGATTCGAAGGAGGCCGTG GGGGAAGTTCGCGGCGGAGATTCGCGACCCGACGAGGAAAGGGGCTAGGATATGGCTGGGGACATTTGACACTGCGGAGC AAGCTGCACGGGCTTATGATGCTGCTGCATTTCATTTTCGTGGTCACAGAGCAATTCTCAACTTCCCCAATGAGTACCAG GCTCCTCCTGATGCAGTGAACTCTTATTCTTTGCAAATGCCTCTCAGTGCTCCTTCTCATGCTTCCAATTCATCTTCTTC TTACTCTGGTGGTGATGGTAACAATGGCATTGTGAAAGCTGAACCTTCTGGAGAGATGCAATTTGGTGATGATCACAGTT TTGAGTTGGAGTACTTTGATAGTAAGTTGCTGGAAGATCTCCTTCAAGATGACAGATATGGGCACTAGAAGCAAATAACA AGCTAGCTAGGGAGTTATGAAACATTAACACCAAAGTTTCCTTTACGTCACAATTCTACATCGATTGGCATGAATTCTGC TGTTTATTCCTAGCTAAGAGACACGTATTCTAAATTCTTGAAACTGAGATGACATTGTAATATTCATTGTGAGAATTTAA TTAGTTGAGAAAATAAGTGACATGGAATGTCAGTGTAATTAAGAACGTTTGCTATGCTCAATGGCTGTTTTTTTTTTTCC TCTTTTCA
CDS sequence (LotjaGi5g1v0180400.1) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGGAGGCAGAGAGACCATCAGGTTCCAATGGAAACAACAATGGGGAGGTTCGTTACAGAGGGATTCGAAGGAGGCCGTG GGGGAAGTTCGCGGCGGAGATTCGCGACCCGACGAGGAAAGGGGCTAGGATATGGCTGGGGACATTTGACACTGCGGAGC AAGCTGCACGGGCTTATGATGCTGCTGCATTTCATTTTCGTGGTCACAGAGCAATTCTCAACTTCCCCAATGAGTACCAG GCTCCTCCTGATGCAGTGAACTCTTATTCTTTGCAAATGCCTCTCAGTGCTCCTTCTCATGCTTCCAATTCATCTTCTTC TTACTCTGGTGGTGATGGTAACAATGGCATTGTGAAAGCTGAACCTTCTGGAGAGATGCAATTTGGTGATGATCACAGTT TTGAGTTGGAGTACTTTGATAGTAAGTTGCTGGAAGATCTCCTTCAAGATGACAGATATGGGCACTAG
Protein sequence (LotjaGi5g1v0180400.1) extracted from Lotus japonicus Gifu v1.2 Proteins.
MEAERPSGSNGNNNGEVRYRGIRRRPWGKFAAEIRDPTRKGARIWLGTFDTAEQAARAYDAAAFHFRGHRAILNFPNEYQ APPDAVNSYSLQMPLSAPSHASNSSSSYSGGDGNNGIVKAEPSGEMQFGDDHSFELEYFDSKLLEDLLQDDRYGH
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
---|---|---|---|---|---|---|
PANTHER | 2 | 152 | 151 | 7.9E-64 | – | |
PANTHER | 2 | 152 | 151 | 7.9E-64 | – | |
Gene3D | 17 | 78 | 62 | 7.7E-32 | ||
SUPERFAMILY | 18 | 77 | 60 | 1.9E-23 | ||
ProSiteProfiles | 18 | 76 | 59 | 25.567 | ||
Pfam | 18 | 69 | 52 | 2.8E-13 | ||
SMART | 18 | 82 | 65 | 8.7E-35 | ||
CDD | 18 | 77 | 60 | 8.08034E-21 | ||
PRINTS | 19 | 30 | 12 | 1.4E-11 | ||
PRINTS | 42 | 58 | 17 | 1.4E-11 | ||
MobiDBLite | 95 | 113 | 19 | - | – | |
MobiDBLite | 95 | 124 | 30 | - | – |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
GO term | Namespace | Name | Definition | Relationships |
---|---|---|---|---|
Molecular function | DNA binding | Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid). | ||
Molecular function | DNA-binding transcription factor activity | A protein or a member of a complex that interacts selectively and non-covalently with a specific DNA sequence (sometimes referred to as a motif) within the regulatory region of a gene to modulate transcription. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons. | ||
Biological process | Regulation of transcription, DNA-templated | Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription. |
Expression pattern of LotjaGi5g1v0180400.1, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…