Transcript — View — Lotus Base

Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi5g1v0184500.1

Overview

Field	Value
Gene ID	LotjaGi5g1v0184500
Transcript ID	LotjaGi5g1v0184500.1
Lotus japonicus genome version	Gifu v1.2
Description	Retrovirus-related Pol polyprotein from transposon TNT 1-94; TAIR: AT1G21280.1 Copia-like polyprotein/retrotransposon; Swiss-Prot: sp\|O31521\|URHG1_BACSU Unsaturated rhamnogalacturonyl hydrolase YesR; TrEMBL-Plants: tr\|A0A151QYF6\|A0A151QYF6_CAJCA Uncharacterized protein; Found in the gene: LotjaGi5g1v0184500
Working Lj name	n.a.

Genomic sequence (LjG1.1_chr5:46924039..46924573) extracted from Lotus japonicus Gifu genome v1.2.

TTCTTCTTCTTCAATCTCTCTCGATCTCTCTCAAGAGTTTTCACATTCTTTGATGGTATCAGTGCCCTAGATTGGGCTCT GCCATCACCAGCTTCCGCAGAAATGGTGCGAAACGCACAAATCAACAACAACAATGGAAATCAGCAAGCGCATGTGGTTC AGGATCCAGCGCAAAATCCGATTTCGCCGTATTACATTCATTCCGGTGAAAATCCGTCGGCTACAATGGTATCTCCACTC CTCAATGGAAGGAACTACAGTGTCTGGGCTCGATCGATGAAGCGAGCACTTGTGGCGAAGAACAAGTTCAAGTTTATCAA TGGCGAAATTCCAGTTGCAGTACCTGGTGATGCCAACTACGATGCTTGGGATCGCTGCAACAGCTTGATCCATTCATGGA TACTCAATTCGGTAACTTCTACAATTGTAATAGCATAGTTTTTGTTGAAAATGCTTGTGATGCTTGGAAGGATCTTCGTG ATCGATTTTCTTAGGGAGATTTAGTGAGAATTGCTGAACTGCAAAATGAAATCAG

Download Genomic Sequence

CDS sequence (LotjaGi5g1v0184500.1) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGGTGCGAAACGCACAAATCAACAACAACAATGGAAATCAGCAAGCGCATGTGGTTCAGGATCCAGCGCAAAATCCGAT TTCGCCGTATTACATTCATTCCGGTGAAAATCCGTCGGCTACAATGGTATCTCCACTCCTCAATGGAAGGAACTACAGTG TCTGGGCTCGATCGATGAAGCGAGCACTTGTGGCGAAGAACAAGTTCAAGTTTATCAATGGCGAAATTCCAGTTGCAGTA CCTGGTGATGCCAACTACGATGCTTGGGATCGCTGCAACAGCTTGATCCATTCATGGATACTCAATTCGGTAACTTCTAC AATTGTAATAGCATAG

Download CDS Sequence

Protein sequence (LotjaGi5g1v0184500.1) extracted from Lotus japonicus Gifu v1.2 Proteins.

MVRNAQINNNNGNQQAHVVQDPAQNPISPYYIHSGENPSATMVSPLLNGRNYSVWARSMKRALVAKNKFKFINGEIPVAV PGDANYDAWDRCNSLIHSWILNSVTSTIVIA

Download Protein Sequence

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Prediction algorithm	Identifier	Start	End	Length	E-value	InterPro ID
PANTHER	PTHR37610:SF7 View details on PTHR37610:SF7 Search for proteins/transripts with this domain View external data on PTHR37610:SF7	20	108	89	5.0E-29	–
PANTHER	PTHR37610 View details on PTHR37610 Search for proteins/transripts with this domain View external data on PTHR37610	20	108	89	5.0E-29	–
Pfam	PF14244 View details on PF14244 Search for proteins/transripts with this domain View external data on PF14244	33	76	44	1.2E-15	IPR029472 Show description in modal box View details on IPR029472 Search for proteins/transripts with this domain View on EBI InterPro Service

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on April 27, 2020, while the GO metadata was last updated on April 27, 2020.

Unable to find any GO terms for the transcript with the identifier.

Genome browser

Expression data

Expression pattern

Expression pattern of LotjaGi5g1v0184500.1, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…