Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi5g1v0223700.1

Overview

Field Value
Gene ID LotjaGi5g1v0223700
Transcript ID LotjaGi5g1v0223700.1
Related isoforms 1
Lotus japonicus genome version Gifu v1.2
Description Cytochrome b6-f complex subunit 4; TAIR: ATCG00730.1 photosynthetic electron transfer D (ChrC); Swiss-Prot: sp|Q9BBQ5|PETD_LOTJA Cytochrome b6-f complex subunit 4; TrEMBL-Plants: tr|A0A1D8R9R1|A0A1D8R9R1_9MAGN Cytochrome b6-f complex subunit 4; Found in the gene: LotjaGi5g1v0223700
Working Lj name n.a.

Sequence information

Genomic sequence (LjG1.1_chr5:53020659..53021183) extracted from Lotus japonicus Gifu genome v1.2.

ATGTCCGGTTCTTTCGGAGGATGGATTTATAAGAATTCACCTATCCCAATAACAAAAAAACCTGACTTGAATGATCCTGT ATTAAGAGCTAAATTGGCTAAAGGAATGGGTCATAATTATTATGGAGAACCCGCATGGCCCAACGATCTTTTATATATTT TTCCAGTAGTGATTCTGGGTACTATTGCATGTAACGTAGGCTTAGCAGTTCTAGAACCATCAATGATTGGGGAACCCGCG GATCCATTTGCAACCCCTTTGGAAATATTGCCCGAATGGTATTTCTTTCCTGTATTTCAAATACTTCGTACAGTGCCAAA TAAGTTATTGGGTGTTCTTTTAATGGTTTCAGTACCCGCAGGATTAGTAACAGTACCCTTTTTGGAAAATGTTAATAAAT TCCAAAATCCATTTCGCCGTCCAGTAGCAACAACCGTTTTTTTAATTGGTACCGCAGTGTCTCTTTGGTTGGGTATTGGA GCAACATTACCCATTGAGAAATCCCTTACTTTAGGTCTTTTTTAA 

CDS sequence (LotjaGi5g1v0223700.1) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGTCCGGTTCTTTCGGAGGATGGATTTATAAGAATTCACCTATCCCAATAACAAAAAAACCTGACTTGAATGATCCTGT ATTAAGAGCTAAATTGGCTAAAGGAATGGGTCATAATTATTATGGAGAACCCGCATGGCCCAACGATCTTTTATATATTT TTCCAGTAGTGATTCTGGGTACTATTGCATGTAACGTAGGCTTAGCAGTTCTAGAACCATCAATGATTGGGGAACCCGCG GATCCATTTGCAACCCCTTTGGAAATATTGCCCGAATGGTATTTCTTTCCTGTATTTCAAATACTTCGTACAGTGCCAAA TAAGTTATTGGGTGTTCTTTTAATGGTTTCAGTACCCGCAGGATTAGTAACAGTACCCTTTTTGGAAAATGTTAATAAAT TCCAAAATCCATTTCGCCGTCCAGTAGCAACAACCGTTTTTTTAATTGGTACCGCAGTGTCTCTTTGGTTGGGTATTGGA GCAACATTACCCATTGAGAAATCCCTTACTTTAGGTCTTTTTTAA 

Protein sequence (LotjaGi5g1v0223700.1) extracted from Lotus japonicus Gifu v1.2 Proteins.

MSGSFGGWIYKNSPIPITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPSMIGEPA DPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPAGLVTVPFLENVNKFQNPFRRPVATTVFLIGTAVSLWLGIG ATLPIEKSLTLGLF 

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Merging data from EBeye. Please wait…

Domains

Sorting

Prediction algorithm Identifier Start End Length E-value InterPro ID
Phobius 1 49 49 -
PANTHER 6 174 169 2.3E-59
PANTHER 6 174 169 2.3E-59
Hamap 15 174 160 45.047
PIRSF 15 174 160 4.1E-94
TIGRFAM 17 174 158 6.3E-100
SUPERFAMILY 21 170 150 1.83E-43
Gene3D 23 80 58 2.4E-37
CDD 28 174 147 4.18004E-59
TMHMM 49 71 23 -
Phobius 50 71 22 -
Phobius 72 108 37 -
ProSiteProfiles 79 174 96 15.816
Pfam 79 168 90 3.0E-19
Gene3D 81 174 94 9.2E-38
Phobius 109 128 20 -
TMHMM 109 128 20 -
Phobius 129 139 11 -
Phobius 140 159 20 -
TMHMM 143 165 23 -
Phobius 160 174 15 -

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .

GO term Namespace Name Definition Relationships
Molecular function Electron transfer activity Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
Biological process Photosynthetic electron transport chain A process, occurring as part of photosynthesis, in which light provides the energy for a series of electron carriers to operate together to transfer electrons and generate a transmembrane electrochemical gradient.
Cellular component Membrane A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
Molecular function Oxidoreductase activity Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
Cellular component Thylakoid membrane The pigmented membrane of any thylakoid.
Molecular function Electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity Enables the directed movement of electrons within the cyclic electron transport pathway of photosynthesis.

Expression data

Expression pattern

Expression pattern of LotjaGi5g1v0223700.1, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…