Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
Field | Value |
---|---|
Gene ID | LotjaGi5g1v0223700 |
Transcript ID | LotjaGi5g1v0223700.1 |
Related isoforms 1 | |
Lotus japonicus genome version | Gifu v1.2 |
Description | Cytochrome b6-f complex subunit 4; TAIR: ATCG00730.1 photosynthetic electron transfer D (ChrC); Swiss-Prot: sp|Q9BBQ5|PETD_LOTJA Cytochrome b6-f complex subunit 4; TrEMBL-Plants: tr|A0A1D8R9R1|A0A1D8R9R1_9MAGN Cytochrome b6-f complex subunit 4; Found in the gene: LotjaGi5g1v0223700 |
Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr5:53020659..53021183) extracted from Lotus japonicus Gifu genome v1.2.
ATGTCCGGTTCTTTCGGAGGATGGATTTATAAGAATTCACCTATCCCAATAACAAAAAAACCTGACTTGAATGATCCTGT ATTAAGAGCTAAATTGGCTAAAGGAATGGGTCATAATTATTATGGAGAACCCGCATGGCCCAACGATCTTTTATATATTT TTCCAGTAGTGATTCTGGGTACTATTGCATGTAACGTAGGCTTAGCAGTTCTAGAACCATCAATGATTGGGGAACCCGCG GATCCATTTGCAACCCCTTTGGAAATATTGCCCGAATGGTATTTCTTTCCTGTATTTCAAATACTTCGTACAGTGCCAAA TAAGTTATTGGGTGTTCTTTTAATGGTTTCAGTACCCGCAGGATTAGTAACAGTACCCTTTTTGGAAAATGTTAATAAAT TCCAAAATCCATTTCGCCGTCCAGTAGCAACAACCGTTTTTTTAATTGGTACCGCAGTGTCTCTTTGGTTGGGTATTGGA GCAACATTACCCATTGAGAAATCCCTTACTTTAGGTCTTTTTTAA
CDS sequence (LotjaGi5g1v0223700.1) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGTCCGGTTCTTTCGGAGGATGGATTTATAAGAATTCACCTATCCCAATAACAAAAAAACCTGACTTGAATGATCCTGT ATTAAGAGCTAAATTGGCTAAAGGAATGGGTCATAATTATTATGGAGAACCCGCATGGCCCAACGATCTTTTATATATTT TTCCAGTAGTGATTCTGGGTACTATTGCATGTAACGTAGGCTTAGCAGTTCTAGAACCATCAATGATTGGGGAACCCGCG GATCCATTTGCAACCCCTTTGGAAATATTGCCCGAATGGTATTTCTTTCCTGTATTTCAAATACTTCGTACAGTGCCAAA TAAGTTATTGGGTGTTCTTTTAATGGTTTCAGTACCCGCAGGATTAGTAACAGTACCCTTTTTGGAAAATGTTAATAAAT TCCAAAATCCATTTCGCCGTCCAGTAGCAACAACCGTTTTTTTAATTGGTACCGCAGTGTCTCTTTGGTTGGGTATTGGA GCAACATTACCCATTGAGAAATCCCTTACTTTAGGTCTTTTTTAA
Protein sequence (LotjaGi5g1v0223700.1) extracted from Lotus japonicus Gifu v1.2 Proteins.
MSGSFGGWIYKNSPIPITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPSMIGEPA DPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPAGLVTVPFLENVNKFQNPFRRPVATTVFLIGTAVSLWLGIG ATLPIEKSLTLGLF
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
---|---|---|---|---|---|---|
Phobius | 1 | 49 | 49 | - | – | |
PANTHER | 6 | 174 | 169 | 2.3E-59 | – | |
PANTHER | 6 | 174 | 169 | 2.3E-59 | – | |
Hamap | 15 | 174 | 160 | 45.047 | ||
PIRSF | 15 | 174 | 160 | 4.1E-94 | ||
TIGRFAM | 17 | 174 | 158 | 6.3E-100 | ||
SUPERFAMILY | 21 | 170 | 150 | 1.83E-43 | ||
Gene3D | 23 | 80 | 58 | 2.4E-37 | – | |
CDD | 28 | 174 | 147 | 4.18004E-59 | ||
TMHMM | 49 | 71 | 23 | - | – | |
Phobius | 50 | 71 | 22 | - | – | |
Phobius | 72 | 108 | 37 | - | – | |
ProSiteProfiles | 79 | 174 | 96 | 15.816 | ||
Pfam | 79 | 168 | 90 | 3.0E-19 | ||
Gene3D | 81 | 174 | 94 | 9.2E-38 | – | |
Phobius | 109 | 128 | 20 | - | – | |
TMHMM | 109 | 128 | 20 | - | – | |
Phobius | 129 | 139 | 11 | - | – | |
Phobius | 140 | 159 | 20 | - | – | |
TMHMM | 143 | 165 | 23 | - | – | |
Phobius | 160 | 174 | 15 | - | – |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
GO term | Namespace | Name | Definition | Relationships |
---|---|---|---|---|
Molecular function | Electron transfer activity | Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient. | ||
Biological process | Photosynthetic electron transport chain | A process, occurring as part of photosynthesis, in which light provides the energy for a series of electron carriers to operate together to transfer electrons and generate a transmembrane electrochemical gradient. | ||
Cellular component | Membrane | A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it. | ||
Molecular function | Oxidoreductase activity | Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced. | ||
Cellular component | Thylakoid membrane | The pigmented membrane of any thylakoid. | ||
Molecular function | Electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity | Enables the directed movement of electrons within the cyclic electron transport pathway of photosynthesis. |
Expression pattern of LotjaGi5g1v0223700.1, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…