Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
| Field | Value |
|---|---|
| Gene ID | LotjaGi6g1v0009500 |
| Transcript ID | LotjaGi6g1v0009500.2 |
| Related isoforms 1 | |
| Lotus japonicus genome version | Gifu v1.2 |
| Description | Ammonium transporter; TAIR: AT4G13510.1 ammonium transporter 1;1; Swiss-Prot: sp|Q6K9G1|AMT12_ORYSJ Ammonium transporter 1 member 2; TrEMBL-Plants: tr|Q9FSH3|Q9FSH3_LOTJA Ammonium transporter; Found in the gene: LotjaGi6g1v0009500 |
| Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr6:1775429..1776079) extracted from Lotus japonicus Gifu genome v1.2.
ATGCTCTGCGCCGGCTCCGTCCGCGCCAAAAACACCATGAACATCATGCTCACCAACGTCCTCGACGCCGCCGCCGGCGG CCTCTTCTACTATCTCTTCGGTTTCGCCTTTGCCTTCGGCGCACCCTCCAACGGCTTCATCGGCCGCCACTTCTTCGGCC TCAAAGACGTCCCCACCGTAGCCTTCGACTACAGCTACTTCCTCTACCAGTGGGCGTTTGCCATCGCCGCCGCCGGGATC ACCAGCGGCTCAATCGCTGAACGCACACAGTTCGTTGCCTACCTCATCTACTCGTCGTTCCTCACCGGGTTTGTCTACCC CGTCGTGTCTCACTGGTTCTGGTCCGGCGACGGTTGGGCCAGCGCCACCAACACCGGGAACTTGCTGTTTGGCACCGGGG TGATTGATTTTGCCGGGTCGGGTGTGGTTCACATGGTTGGTGGTGTTGCGGGTCTTTGGGGCGCGCTTATTGAGGGACCC AGGATTGGCCGGTTTGACCATGCCGGTCGAGCCGTTTCGCTTCGCGGACACAGTGCTTCGCTTGTTGTGCTTGGAACCTT CATGCTCTGGTTCGGTTGGTACGGTTTTAACCCCGGTTCGTTCACCAAGATTCTCAGCGCCTATGATTCAGGTAACAGCT GGCTCCAATAA
CDS sequence (LotjaGi6g1v0009500.2) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGCTCTGCGCCGGCTCCGTCCGCGCCAAAAACACCATGAACATCATGCTCACCAACGTCCTCGACGCCGCCGCCGGCGG CCTCTTCTACTATCTCTTCGGTTTCGCCTTTGCCTTCGGCGCACCCTCCAACGGCTTCATCGGCCGCCACTTCTTCGGCC TCAAAGACGTCCCCACCGTAGCCTTCGACTACAGCTACTTCCTCTACCAGTGGGCGTTTGCCATCGCCGCCGCCGGGATC ACCAGCGGCTCAATCGCTGAACGCACACAGTTCGTTGCCTACCTCATCTACTCGTCGTTCCTCACCGGGTTTGTCTACCC CGTCGTGTCTCACTGGTTCTGGTCCGGCGACGGTTGGGCCAGCGCCACCAACACCGGGAACTTGCTGTTTGGCACCGGGG TGATTGATTTTGCCGGGTCGGGTGTGGTTCACATGGTTGGTGGTGTTGCGGGTCTTTGGGGCGCGCTTATTGAGGGACCC AGGATTGGCCGGTTTGACCATGCCGGTCGAGCCGTTTCGCTTCGCGGACACAGTGCTTCGCTTGTTGTGCTTGGAACCTT CATGCTCTGGTTCGGTTGGTACGGTTTTAACCCCGGTTCGTTCACCAAGATTCTCAGCGCCTATGATTCAGGTAACAGCT GGCTCCAATAA
Protein sequence (LotjaGi6g1v0009500.2) extracted from Lotus japonicus Gifu v1.2 Proteins.
MLCAGSVRAKNTMNIMLTNVLDAAAGGLFYYLFGFAFAFGAPSNGFIGRHFFGLKDVPTVAFDYSYFLYQWAFAIAAAGI TSGSIAERTQFVAYLIYSSFLTGFVYPVVSHWFWSGDGWASATNTGNLLFGTGVIDFAGSGVVHMVGGVAGLWGALIEGP RIGRFDHAGRAVSLRGHSASLVVLGTFMLWFGWYGFNPGSFTKILSAYDSGNSWLQ
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
| Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
|---|---|---|---|---|---|---|
| SUPERFAMILY | 1 | 203 | 203 | 4.32E-55 | – | |
| Pfam | 1 | 208 | 208 | 2.5E-69 | ||
| Gene3D | 1 | 214 | 214 | 1.0E-73 | ||
| PANTHER | 1 | 212 | 212 | 1.0E-126 | – | |
| PANTHER | 1 | 212 | 212 | 1.0E-126 | – | |
| Phobius | 1 | 19 | 19 | - | – | |
| TMHMM | 20 | 42 | 23 | - | – | |
| Phobius | 20 | 41 | 22 | - | – | |
| Phobius | 42 | 60 | 19 | - | – | |
| Phobius | 61 | 80 | 20 | - | – | |
| TMHMM | 67 | 86 | 20 | - | – | |
| Phobius | 81 | 91 | 11 | - | – | |
| Phobius | 92 | 114 | 23 | - | – | |
| TMHMM | 93 | 115 | 23 | - | – | |
| Phobius | 115 | 133 | 19 | - | – | |
| Phobius | 134 | 157 | 24 | - | – | |
| TMHMM | 135 | 157 | 23 | - | – | |
| ProSitePatterns | 136 | 161 | 26 | - | ||
| Phobius | 158 | 177 | 20 | - | – | |
| TMHMM | 178 | 197 | 20 | - | – | |
| Phobius | 178 | 196 | 19 | - | – | |
| Phobius | 197 | 216 | 20 | - | – |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
| GO term | Namespace | Name | Definition | Relationships |
|---|---|---|---|---|
| Molecular function | Ammonium transmembrane transporter activity | Enables the transfer of ammonium from one side of a membrane to the other. Ammonium is the cation NH4+ which is formed from N2 by root-nodule bacteria in leguminous plants and is an excretory product in ammonotelic animals. | ||
| Biological process | Ammonium transport | The directed movement of ammonium into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Ammonium is the cation NH4+ which is formed from N2 by root-nodule bacteria in leguminous plants and is an excretory product in ammonotelic animals. | ||
| Cellular component | Membrane | A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it. | ||
| Biological process | Ammonium transmembrane transport | The process in which ammonium is transported across a membrane. Ammonium is the cation NH4+. |
Expression pattern of LotjaGi6g1v0009500.2, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…