Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi1g1v0392400.1

Overview

Field Value
Gene ID LotjaGi1g1v0392400
Transcript ID LotjaGi1g1v0392400.1
Lotus japonicus genome version Gifu v1.2
Description Eukaryotic translation initiation factor 1A; TAIR: AT2G04520.1 Nucleic acid-binding, OB-fold-like protein; Swiss-Prot: sp|P56331|IF1A_ONOVI Eukaryotic translation initiation factor 1A; TrEMBL-Plants: tr|I3SHT8|I3SHT8_LOTJA Uncharacterized protein; Found in the gene: LotjaGi1g1v0392400
Working Lj name n.a.

Sequence information

Genomic sequence (LjG1.1_chr1:87694327..87694783) extracted from Lotus japonicus Gifu genome v1.2.

ATGCCGAAGAACAAGGGAAAGGGAGGAAAGAATCGTAAGAGAGGTAAGAACGAAGCCGACGACGAGAAGAGAGAGCTCGT TTTCAAGGAAGACGGCCAGGAGTACGCGCAGGTCCTCCGCATGCTCGGCAACGGCCGCTGTGAAGCCATGTGCATCGACG GCACCAAACGCCTCTGTCACATCCGCGGTAAGATGCACAAGAAGGTCTGGATCGCCGCCGGCGATATCATCCTCGTCGGC CTCCGTGATTATCAGGATGATAAGGCGGATGTGATTCTCAAGTACATGCCGGATGAGGCGAGGCTGCTTAAGGCGTACGG TGAGCTTCCGGAGAATACTCGGTTGAATGAGGGGATTGGTGGTGGTTTGGATGAGGAGGATGAAGCTACTGCTAATGATT ACATTGAGTTTGAGGATGAGGATATTGATAAAATCTAAATCTTTTTTTAAATTATAA 

CDS sequence (LotjaGi1g1v0392400.1) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGCCGAAGAACAAGGGAAAGGGAGGAAAGAATCGTAAGAGAGGTAAGAACGAAGCCGACGACGAGAAGAGAGAGCTCGT TTTCAAGGAAGACGGCCAGGAGTACGCGCAGGTCCTCCGCATGCTCGGCAACGGCCGCTGTGAAGCCATGTGCATCGACG GCACCAAACGCCTCTGTCACATCCGCGGTAAGATGCACAAGAAGGTCTGGATCGCCGCCGGCGATATCATCCTCGTCGGC CTCCGTGATTATCAGGATGATAAGGCGGATGTGATTCTCAAGTACATGCCGGATGAGGCGAGGCTGCTTAAGGCGTACGG TGAGCTTCCGGAGAATACTCGGTTGAATGAGGGGATTGGTGGTGGTTTGGATGAGGAGGATGAAGCTACTGCTAATGATT ACATTGAGTTTGAGGATGAGGATATTGATAAAATCTAA 

Protein sequence (LotjaGi1g1v0392400.1) extracted from Lotus japonicus Gifu v1.2 Proteins.

MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDIILVG LRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIGGGLDEEDEATANDYIEFEDEDIDKI 

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Merging data from EBeye. Please wait…

Domains

Sorting

Prediction algorithm Identifier Start End Length E-value InterPro ID
MobiDBLite 1 25 25 -
PANTHER 1 145 145 1.9E-87
PANTHER 1 145 145 1.9E-87
Gene3D 2 145 144 1.3E-55
SUPERFAMILY 2 144 143 4.0E-46
TIGRFAM 14 110 97 8.1E-35
Hamap 16 110 95 18.345
ProSiteProfiles 22 96 75 31.624
SMART 28 110 83 7.0E-49
Pfam 32 93 62 2.3E-21
CDD 33 109 77 3.39797E-42
ProSitePatterns 41 63 23 -

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .

GO term Namespace Name Definition Relationships
Molecular function RNA binding Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
Molecular function Translation initiation factor activity Functions in the initiation of ribosome-mediated translation of mRNA into a polypeptide.
Biological process Translational initiation The process preceding formation of the peptide bond between the first two amino acids of a protein. This includes the formation of a complex of the ribosome, mRNA or circRNA, and an initiation complex that contains the first aminoacyl-tRNA.

Expression data

Expression pattern

Expression pattern of LotjaGi1g1v0392400.1, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…