Transcript — View — Lotus Base

Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi1g1v0398300.1

Overview

Field	Value
Gene ID	LotjaGi1g1v0398300
Transcript ID	LotjaGi1g1v0398300.1
Lotus japonicus genome version	Gifu v1.2
Description	tRNA (guanine-N(7)-)-methyltransferase; TAIR: AT5G24840.1 tRNA (guanine-N-7) methyltransferase; Swiss-Prot: sp\|Q8GXB7\|TRMB_ARATH tRNA (guanine-N(7)-)-methyltransferase; TrEMBL-Plants: tr\|I3SH34\|I3SH34_LOTJA tRNA (guanine-N(7)-)-methyltransferase; Found in the gene: LotjaGi1g1v0398300
Working Lj name	n.a.

Genomic sequence (LjG1.1_chr1:88485221..88485988) extracted from Lotus japonicus Gifu genome v1.2.

ATGTCTGAGACTGAGATAAATCCAACCTTCAGCAAGTCAACTGGATTGCCTCGAAAGCGCTTCTATCGTGCACGAGCACA CAGCAATCCACTTAGTGACTCACACTTTCCTGTGCCAATATCTCCCAGGCACGTGGACTATTCCCTCCATTACCCTCAGC TCTTTCCCTCGTCTGATAGAGCTGACAGTTCCAGAAAGGTCCAGTTTGCTGATATTGGCTGTGGTTTTGGCGGGCTTCTT ATCAGTCTTGCCACCCTGTTCCCAGAAACACTGATGATTGGAATGGAACTTAGAGATAAAGTGTCTGAGTATGTCAAGGA AAGAATTTTATCTTTAAGGGTGGCAAATCCAGGTCAATACCAAAATGTTTCTGTGGTACGGACTAACTCCATGAAGTACA TTCCCAATTACTTTGAGAAAGGACAACTGTCAAAGATGTTTTTCTTGTTTCCTGATCCTCATTTTAAAGAGAAAAATCAC CGCCGTCGGGTTATCAGTCCGTTCTTGCTAGATGAATATGCTTATACTCTTGAGGTTGGTGGAATTATATACACAATAAC GGATGTAGAAGAACTTGGGGACTGGATGAAGTCTTGCCTAGAGAATCATCCCATGTTTGAACCCCTGACTGAGAAAGAAC TTGAAGCAGATCCAGTTGTGATGCTTTTAAGCTCTGCAACCGAAGAAGGCCAAAAGGTTGCTAGAAATGGTGGACAAACT TTCCAGGCTGTTTTCAGGCGAATTGTGCCATCCGATCAGTCATCCTAG

Download Genomic Sequence

CDS sequence (LotjaGi1g1v0398300.1) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGTCTGAGACTGAGATAAATCCAACCTTCAGCAAGTCAACTGGATTGCCTCGAAAGCGCTTCTATCGTGCACGAGCACA CAGCAATCCACTTAGTGACTCACACTTTCCTGTGCCAATATCTCCCAGGCACGTGGACTATTCCCTCCATTACCCTCAGC TCTTTCCCTCGTCTGATAGAGCTGACAGTTCCAGAAAGGTCCAGTTTGCTGATATTGGCTGTGGTTTTGGCGGGCTTCTT ATCAGTCTTGCCACCCTGTTCCCAGAAACACTGATGATTGGAATGGAACTTAGAGATAAAGTGTCTGAGTATGTCAAGGA AAGAATTTTATCTTTAAGGGTGGCAAATCCAGGTCAATACCAAAATGTTTCTGTGGTACGGACTAACTCCATGAAGTACA TTCCCAATTACTTTGAGAAAGGACAACTGTCAAAGATGTTTTTCTTGTTTCCTGATCCTCATTTTAAAGAGAAAAATCAC CGCCGTCGGGTTATCAGTCCGTTCTTGCTAGATGAATATGCTTATACTCTTGAGGTTGGTGGAATTATATACACAATAAC GGATGTAGAAGAACTTGGGGACTGGATGAAGTCTTGCCTAGAGAATCATCCCATGTTTGAACCCCTGACTGAGAAAGAAC TTGAAGCAGATCCAGTTGTGATGCTTTTAAGCTCTGCAACCGAAGAAGGCCAAAAGGTTGCTAGAAATGGTGGACAAACT TTCCAGGCTGTTTTCAGGCGAATTGTGCCATCCGATCAGTCATCCTAG

Download CDS Sequence

Protein sequence (LotjaGi1g1v0398300.1) extracted from Lotus japonicus Gifu v1.2 Proteins.

MSETEINPTFSKSTGLPRKRFYRARAHSNPLSDSHFPVPISPRHVDYSLHYPQLFPSSDRADSSRKVQFADIGCGFGGLL ISLATLFPETLMIGMELRDKVSEYVKERILSLRVANPGQYQNVSVVRTNSMKYIPNYFEKGQLSKMFFLFPDPHFKEKNH RRRVISPFLLDEYAYTLEVGGIIYTITDVEELGDWMKSCLENHPMFEPLTEKELEADPVVMLLSSATEEGQKVARNGGQT FQAVFRRIVPSDQSS

Download Protein Sequence

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Prediction algorithm	Identifier	Start	End	Length	E-value	InterPro ID
PANTHER	PTHR23417 View details on PTHR23417 Search for proteins/transripts with this domain View external data on PTHR23417	1	248	248	1.4E-121	IPR003358 Show description in modal box View details on IPR003358 Search for proteins/transripts with this domain View on EBI InterPro Service
PANTHER	PTHR23417:SF16 View details on PTHR23417:SF16 Search for proteins/transripts with this domain View external data on PTHR23417:SF16	1	248	248	1.4E-121	IPR025763 Show description in modal box View details on IPR025763 Search for proteins/transripts with this domain View on EBI InterPro Service
Hamap	MF_03055 View details on MF_03055 Search for proteins/transripts with this domain View external data on MF_03055	16	248	233	44.402	IPR025763 Show description in modal box View details on IPR025763 Search for proteins/transripts with this domain View on EBI InterPro Service
ProSiteProfiles	PS51625 View details on PS51625 Search for proteins/transripts with this domain View external data on PS51625	19	247	229	59.264	IPR003358 Show description in modal box View details on IPR003358 Search for proteins/transripts with this domain View on EBI InterPro Service
Gene3D	G3DSA:3.40.50.150 View details on G3DSA:3.40.50.150 Search for proteins/transripts with this domain View external data on G3DSA:3.40.50.150	45	247	203	6.3E-81	–
TIGRFAM	TIGR00091 View details on TIGR00091 Search for proteins/transripts with this domain View external data on TIGR00091	64	248	185	1.8E-41	IPR003358 Show description in modal box View details on IPR003358 Search for proteins/transripts with this domain View on EBI InterPro Service
SUPERFAMILY	SSF53335 View details on SSF53335 Search for proteins/transripts with this domain View external data on SSF53335	64	245	182	2.46E-20	IPR029063 Show description in modal box View details on IPR029063 Search for proteins/transripts with this domain View on EBI InterPro Service
Pfam	PF02390 View details on PF02390 Search for proteins/transripts with this domain View external data on PF02390	66	242	177	6.7E-51	IPR003358 Show description in modal box View details on IPR003358 Search for proteins/transripts with this domain View on EBI InterPro Service
CDD	cd02440 View details on cd02440 Search for proteins/transripts with this domain View external data on cd02440	69	186	118	0.00104342	–

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on April 27, 2020, while the GO metadata was last updated on April 27, 2020.

GO term	Namespace	Name	Definition	Relationships
GO:0006400 View details of GO:0006400 AmiGO InterPro QuickGO	Biological process	TRNA modification	The covalent alteration of one or more nucleotides within a tRNA molecule to produce a tRNA molecule with a sequence that differs from that coded genetically.	Subterm of View details of GO:0008033 View details of GO:0009451
GO:0008176 View details of GO:0008176 AmiGO InterPro QuickGO	Molecular function	TRNA (guanine-N7-)-methyltransferase activity	Catalysis of the reaction: S-adenosyl-L-methionine + tRNA = S-adenosyl-L-homocysteine + tRNA containing N7-methylguanine.	Subterm of View details of GO:0016423

Genome browser

Expression data

Expression pattern

Expression pattern of LotjaGi1g1v0398300.1, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…