Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
Field | Value |
---|---|
Gene ID | LotjaGi1g1v0510400 |
Transcript ID | LotjaGi1g1v0510400.1 |
Lotus japonicus genome version | Gifu v1.2 |
Description | Expansin; TAIR: AT5G39280.1 expansin A23; Swiss-Prot: sp|Q9FL79|EXP23_ARATH Expansin-A23; TrEMBL-Plants: tr|A0A151TCF6|A0A151TCF6_CAJCA Expansin-A22; Found in the gene: LotjaGi1g1v0510400 |
Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr1:102966960..102967654) extracted from Lotus japonicus Gifu genome v1.2.
AAGCACCGCACTATTCAACAATGGGCTTGCATGTGGTTCATGTTATGAGATCAAGTGCGTCAATGACCCCCAATGGTGCA TACCGAACGTGCGCCCAATCAAAATCACGGCCACAAATTTTTGCCCTCCCAATTACACCAAAACCGAAGGCGTTTGGTGC AACCCGCCACAAAAACACTTTGACTTATCAATGAAAATGTTCACCACAATCGCCATTTACAGAGCTGGGATCATCCCGGT TCAATATCGCCGCGTTCCATGCATGAAAACCGGCGGTGTCAAGTTTGAGCTCAAAGGAAACCCTTATTGGTTGCTTGTTT TGGTGTATAATGTTGGGAATGCCGGTGATGTTGCTAGCGTGAGCATCAAAGGTTCCAACACTGGATGGCTTTCAATGAAA CGCATTTGGGGGCAGAATTGGAATACCGGAGTTAATTTGGTCGGACAATCGTTGTCATTTAAGGTTATTACAAGTGATGG TAGAAAGTTGTACTTTATTAATGTTGCTCCTCCCCAATGGCAATTTAGACAATCATACGAGGGCAAGAAGAATTTTTAGA TGTTGTTGCAGTCTCTGATGGTACCGTTTCAATTCTAGTCATTTGTTTAGTTTTAGAGGCTTGTGATTTCCTCTATTGCT AGAATGACTTCTCAGTTCTCAGTGTAATTGCAGAATTAACACGTGACAATAATTT
CDS sequence (LotjaGi1g1v0510400.1) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGAAAATGTTCACCACAATCGCCATTTACAGAGCTGGGATCATCCCGGTTCAATATCGCCGCGTTCCATGCATGAAAAC CGGCGGTGTCAAGTTTGAGCTCAAAGGAAACCCTTATTGGTTGCTTGTTTTGGTGTATAATGTTGGGAATGCCGGTGATG TTGCTAGCGTGAGCATCAAAGGTTCCAACACTGGATGGCTTTCAATGAAACGCATTTGGGGGCAGAATTGGAATACCGGA GTTAATTTGGTCGGACAATCGTTGTCATTTAAGGTTATTACAAGTGATGGTAGAAAGTTGTACTTTATTAATGTTGCTCC TCCCCAATGGCAATTTAGACAATCATACGAGGGCAAGAAGAATTTTTAG
Protein sequence (LotjaGi1g1v0510400.1) extracted from Lotus japonicus Gifu v1.2 Proteins.
MKMFTTIAIYRAGIIPVQYRRVPCMKTGGVKFELKGNPYWLLVLVYNVGNAGDVASVSIKGSNTGWLSMKRIWGQNWNTG VNLVGQSLSFKVITSDGRKLYFINVAPPQWQFRQSYEGKKNF
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
---|---|---|---|---|---|---|
PANTHER | 1 | 122 | 122 | 1.8E-57 | – | |
PANTHER | 1 | 122 | 122 | 1.8E-57 | – | |
SUPERFAMILY | 2 | 28 | 27 | 6.8E-5 | ||
PRINTS | 4 | 17 | 14 | 4.0E-33 | ||
PRINTS | 12 | 28 | 17 | 2.3E-15 | ||
SUPERFAMILY | 26 | 118 | 93 | 2.75E-32 | ||
Gene3D | 27 | 122 | 96 | 3.4E-23 | ||
PRINTS | 28 | 40 | 13 | 4.0E-33 | ||
Pfam | 30 | 107 | 78 | 2.9E-23 | ||
ProSiteProfiles | 39 | 118 | 80 | 20.614 | ||
PRINTS | 40 | 61 | 22 | 4.0E-33 | ||
PRINTS | 66 | 80 | 15 | 2.3E-15 | ||
PRINTS | 75 | 96 | 22 | 4.0E-33 | ||
PRINTS | 104 | 120 | 17 | 4.0E-33 | ||
PRINTS | 104 | 118 | 15 | 2.3E-15 |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
GO term | Namespace | Name | Definition | Relationships |
---|---|---|---|---|
Cellular component | Extracellular region | The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite. | ||
Biological process | Plant-type cell wall organization | A process that results in the assembly and arrangement of constituent parts of the cellulose and pectin-containing cell wall, or in the disassembly of the cellulose and pectin-containing cell wall. This process is carried out at the cellular level. An example of this process is found in Arabidopsis thaliana. |
Expression pattern of LotjaGi1g1v0510400.1, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…