Transcript — View — Lotus Base

Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi1g1v0741000.2

Overview

Field	Value
Gene ID	LotjaGi1g1v0741000
Transcript ID	LotjaGi1g1v0741000.2
Related isoforms 1	LotjaGi1g1v0741000.1
Lotus japonicus genome version	Gifu v1.2
Description	Glucosamine 6-phosphate N-acetyltransferase; TAIR: AT5G15770.1 glucose-6-phosphate acetyltransferase 1; Swiss-Prot: sp\|Q9LFU9\|GNA1_ARATH Glucosamine 6-phosphate N-acetyltransferase; TrEMBL-Plants: tr\|G7KQU8\|G7KQU8_MEDTR Glucosamine 6-phosphate N-acetyltransferase; Found in the gene: LotjaGi1g1v0741000
Working Lj name	n.a.

Genomic sequence (LjG1.1_chr1:131489297..131489758) extracted from Lotus japonicus Gifu genome v1.2.

ATGGAAAAGAGTGAGGAAGAAAAGTTTAGAGTTAGAAAGTTAGAGATCTCTGATAAGGGAAAAGGTTTCATAGAGTTACT GCGACAGCTAAGCGTTTGTGATTCTGTATCTGATAAGGAATTCGAGGATCGGTTCCGGGAGCTCAGTTCTCTTGGAGATG ATCATGTTATCTGTGTCATTGAGGATGAGCTTGCCGGGAAGATCGTTGCGACAGGGAGTGTGTTTATTGAGAAGAAGTTT TTGAGGAACTGTGGTAAAGTTGGACATGTTGAGGATGTTGTTGTGGATTCCAATGTTCGCGGGAAGCAGTTGGGGAAGAA AATTATCAACTTCCTCACGGATCATGCGCGATCGGTGGGGTGCTATAAGGTGATTCTGGATTGCAGCCTTGAGAACAAGG TGTTCTATGAGAAATGTGGCTTTGAGCAGAAGTCAGTTCAGATGGCTATGTATTTTGATTGA

Download Genomic Sequence

CDS sequence (LotjaGi1g1v0741000.2) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGGAAAAGAGTGAGGAAGAAAAGTTTAGAGTTAGAAAGTTAGAGATCTCTGATAAGGGAAAAGGTTTCATAGAGTTACT GCGACAGCTAAGCGTTTGTGATTCTGTATCTGATAAGGAATTCGAGGATCGGTTCCGGGAGCTCAGTTCTCTTGGAGATG ATCATGTTATCTGTGTCATTGAGGATGAGCTTGCCGGGAAGATCGTTGCGACAGGGAGTGTGTTTATTGAGAAGAAGTTT TTGAGGAACTGTGGTAAAGTTGGACATGTTGAGGATGTTGTTGTGGATTCCAATGTTCGCGGGAAGCAGTTGGGGAAGAA AATTATCAACTTCCTCACGGATCATGCGCGATCGGTGGGGTGCTATAAGGTGATTCTGGATTGCAGCCTTGAGAACAAGG TGTTCTATGAGAAATGTGGCTTTGAGCAGAAGTCAGTTCAGATGGCTATGTATTTTGATTGA

Download CDS Sequence

Protein sequence (LotjaGi1g1v0741000.2) extracted from Lotus japonicus Gifu v1.2 Proteins.

MEKSEEEKFRVRKLEISDKGKGFIELLRQLSVCDSVSDKEFEDRFRELSSLGDDHVICVIEDELAGKIVATGSVFIEKKF LRNCGKVGHVEDVVVDSNVRGKQLGKKIINFLTDHARSVGCYKVILDCSLENKVFYEKCGFEQKSVQMAMYFD

Download Protein Sequence

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Prediction algorithm	Identifier	Start	End	Length	E-value	InterPro ID
Gene3D	G3DSA:3.40.630.30 View details on G3DSA:3.40.630.30 Search for proteins/transripts with this domain View external data on G3DSA:3.40.630.30	1	149	149	7.6E-47	–
PANTHER	PTHR13355:SF11 View details on PTHR13355:SF11 Search for proteins/transripts with this domain View external data on PTHR13355:SF11	2	152	151	8.1E-67	–
PANTHER	PTHR13355 View details on PTHR13355 Search for proteins/transripts with this domain View external data on PTHR13355	2	152	151	8.1E-67	IPR039143 Show description in modal box View details on IPR039143 Search for proteins/transripts with this domain View on EBI InterPro Service
ProSiteProfiles	PS51186 View details on PS51186 Search for proteins/transripts with this domain View external data on PS51186	9	153	145	16.609	IPR000182 Show description in modal box View details on IPR000182 Search for proteins/transripts with this domain View on EBI InterPro Service
SUPERFAMILY	SSF55729 View details on SSF55729 Search for proteins/transripts with this domain View external data on SSF55729	9	153	145	2.87E-25	IPR016181 Show description in modal box View details on IPR016181 Search for proteins/transripts with this domain View on EBI InterPro Service
Pfam	PF00583 View details on PF00583 Search for proteins/transripts with this domain View external data on PF00583	38	141	104	1.7E-15	IPR000182 Show description in modal box View details on IPR000182 Search for proteins/transripts with this domain View on EBI InterPro Service
CDD	cd04301 View details on cd04301 Search for proteins/transripts with this domain View external data on cd04301	59	127	69	2.09828E-8	–

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on April 27, 2020, while the GO metadata was last updated on April 27, 2020.

GO term	Namespace	Name	Definition	Relationships
GO:0004343 View details of GO:0004343 AmiGO InterPro QuickGO	Molecular function	Glucosamine 6-phosphate N-acetyltransferase activity	Catalysis of the reaction: D-glucosamine 6-phosphate + acetyl-CoA = N-acetyl-D-glucosamine 6-phosphate + CoA + H(+).	Subterm of View details of GO:0008080
GO:0006048 View details of GO:0006048 AmiGO InterPro QuickGO	Biological process	UDP-N-acetylglucosamine biosynthetic process	The chemical reactions and pathways resulting in the formation of UDP-N-acetylglucosamine, a substance composed of N-acetylglucosamine, a common structural unit of oligosaccharides, in glycosidic linkage with uridine diphosphate.	Subterm of View details of GO:0006047 View details of GO:0009226 View details of GO:0046349
GO:0008080 View details of GO:0008080 AmiGO InterPro QuickGO	Molecular function	N-acetyltransferase activity	Catalysis of the transfer of an acetyl group to a nitrogen atom on the acceptor molecule.	Subterm of View details of GO:0016407 View details of GO:0016410

Genome browser

Expression data

Expression pattern

Expression pattern of LotjaGi1g1v0741000.2, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…