Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi2g1v0059400.4

Overview

Field Value
Gene ID LotjaGi2g1v0059400
Transcript ID LotjaGi2g1v0059400.4
Related isoforms 3
Lotus japonicus genome version Gifu v1.2
Description Protein YIF1B; TAIR: AT3G59500.1 Integral membrane HRF1 family protein; Swiss-Prot: sp|Q4FZQ0|YF1BB_XENLA Protein YIF1B-B; TrEMBL-Plants: tr|I3SF42|I3SF42_LOTJA Uncharacterized protein; Found in the gene: LotjaGi2g1v0059400
Working Lj name n.a.

Sequence information

Genomic sequence (LjG1.1_chr2:12362887..12363329) extracted from Lotus japonicus Gifu genome v1.2.

TTATCTATAACATGCTTTGTCATGGTTTCCTTAAAGATGTTGTATTTATGTCCAGGTTTAGTCCAGAGGCTTTGAACTTG TTATTCATCAAGGGATTGCTTGGTTGGTTTATGCAAGCCTCACTGCTTAAGATGACTTTGCTTTCACTGGGCAGTGGGGA AGCTCCACTGCTGGACATCATAGCATATGCTGGATATACTTTCACTGGCATATGTTTGGCTGTTCTTGGAAGAATAATTT TGGGCTACTCCTACTACTTTTTGATGCCATGGACCTGTTTATGCATGGCAGTATTTTTGGTGAAAACAATGAAGAGAGTT CTTTTTGCGGAGGTTAGGACTTATGACTCCAGCAAACACCACTATCTCTTGCTCTTCATTGCTTTGGTCCAGTTCCCATT GTTCACATGGCTTGGCAACATTACTGTCAATTGGCTTTTATAG 

CDS sequence (LotjaGi2g1v0059400.4) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGCTTTGTCATGGTTTCCTTAAAGATGTTGTATTTATGTCCAGGTTTAGTCCAGAGGCTTTGAACTTGTTATTCATCAA GGGATTGCTTGGTTGGTTTATGCAAGCCTCACTGCTTAAGATGACTTTGCTTTCACTGGGCAGTGGGGAAGCTCCACTGC TGGACATCATAGCATATGCTGGATATACTTTCACTGGCATATGTTTGGCTGTTCTTGGAAGAATAATTTTGGGCTACTCC TACTACTTTTTGATGCCATGGACCTGTTTATGCATGGCAGTATTTTTGGTGAAAACAATGAAGAGAGTTCTTTTTGCGGA GGTTAGGACTTATGACTCCAGCAAACACCACTATCTCTTGCTCTTCATTGCTTTGGTCCAGTTCCCATTGTTCACATGGC TTGGCAACATTACTGTCAATTGGCTTTTATAG 

Protein sequence (LotjaGi2g1v0059400.4) extracted from Lotus japonicus Gifu v1.2 Proteins.

MLCHGFLKDVVFMSRFSPEALNLLFIKGLLGWFMQASLLKMTLLSLGSGEAPLLDIIAYAGYTFTGICLAVLGRIILGYS YYFLMPWTCLCMAVFLVKTMKRVLFAEVRTYDSSKHHYLLLFIALVQFPLFTWLGNITVNWLL 

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Merging data from EBeye. Please wait…

Domains

Sorting

Prediction algorithm Identifier Start End Length E-value InterPro ID
Phobius 1 19 19 -
PANTHER 13 143 131 1.4E-78
PANTHER 13 143 131 1.4E-78
Pfam 14 134 121 5.2E-18
Phobius 20 39 20 -
TMHMM 20 39 20 -
Phobius 40 50 11 -
Phobius 51 73 23 -
TMHMM 54 73 20 -
Phobius 74 78 5 -
TMHMM 75 97 23 -
Phobius 79 97 19 -
Phobius 98 117 20 -
TMHMM 117 139 23 -
Phobius 118 142 25 -
Phobius 143 143 1 -

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .

GO term Namespace Name Definition Relationships
Cellular component Endoplasmic reticulum membrane The lipid bilayer surrounding the endoplasmic reticulum.
Biological process ER to Golgi vesicle-mediated transport The directed movement of substances from the endoplasmic reticulum (ER) to the Golgi, mediated by COP II vesicles. Small COP II coated vesicles form from the ER and then fuse directly with the cis-Golgi. Larger structures are transported along microtubules to the cis-Golgi.

Expression data

Expression pattern

Expression pattern of LotjaGi2g1v0059400.4, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…