Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
Field | Value |
---|---|
Gene ID | LotjaGi4g1v0252100 |
Transcript ID | LotjaGi4g1v0252100.5 |
Related isoforms 4 | |
Lotus japonicus genome version | Gifu v1.2 |
Description | Eukaryotic translation initiation factor 5A; TAIR: AT1G13950.1 eukaryotic elongation factor 5A-1; Swiss-Prot: sp|Q9AXJ4|IF5A_MANES Eukaryotic translation initiation factor 5A; TrEMBL-Plants: tr|I3SPM6|I3SPM6_LOTJA Eukaryotic translation initiation factor 5A; Found in the gene: LotjaGi4g1v0252100 |
Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr4:60580657..60581244) extracted from Lotus japonicus Gifu genome v1.2.
ATGTCTGACGAGGAGCACCATTTCGAGTCCAAGGCCGACGCCGGAGCCTCCAAAACCTACCCTCAACAAGCCGGTACCAT CCGCAAAAACGGCTACATCAACATCAAGAACCGCCCCTGCAAGGTTTAGATCTCGCGTCTTGATTCTTATTATCATTTTT CATTTTCCCCTAATTTCAGGTTTTGATTTGTTCCACTTTTGGTTGATTGAACTGCAGGTTGTTGAAGTTTCCACTTCCAA GACTGGGAAGCACGGTCATGCTAAGTGCCACTTTGTTGGAATTGATATCTTCACTGGCAAGAAGCTTGAGGATATTGTTC CTTCTTCTCATAATTGTGATGTATGCTGCTGCATACCCATTAATCTTATTATGATTTAATTTATTATTTTTTGCGAAAAT TGTTATTAAGATTTTTTTTTTGCGTGGTTAGGTTCCTCATGTGACTCGTACTGATTACCAGCTCATTGATATTTCTGAGG ATGGATTTGTGAGTTTAACTTAACACCTTCCTTTAATTCATTCCATGTTGTTGTTGGTGTTGATTTTTCTTCTGTATTTT TAATTTGTATAAATGCTATTAGGACTAA
CDS sequence (LotjaGi4g1v0252100.5) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGTCTGACGAGGAGCACCATTTCGAGTCCAAGGCCGACGCCGGAGCCTCCAAAACCTACCCTCAACAAGCCGGTACCAT CCGCAAAAACGGCTACATCAACATCAAGAACCGCCCCTGCAAGGTTGTTGAAGTTTCCACTTCCAAGACTGGGAAGCACG GTCATGCTAAGTGCCACTTTGTTGGAATTGATATCTTCACTGGCAAGAAGCTTGAGGATATTGTTCCTTCTTCTCATAAT TGTGATGTTCCTCATGTGACTCGTACTGATTACCAGCTCATTGATATTTCTGAGGATGGATTTGACTAA
Protein sequence (LotjaGi4g1v0252100.5) extracted from Lotus japonicus Gifu v1.2 Proteins.
MSDEEHHFESKADAGASKTYPQQAGTIRKNGYINIKNRPCKVVEVSTSKTGKHGHAKCHFVGIDIFTGKKLEDIVPSSHN CDVPHVTRTDYQLIDISEDGFD
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
---|---|---|---|---|---|---|
PANTHER | 1 | 101 | 101 | 9.2E-81 | – | |
MobiDBLite | 1 | 27 | 27 | - | – | |
PANTHER | 1 | 101 | 101 | 9.2E-81 | ||
Gene3D | 1 | 85 | 85 | 1.3E-46 | ||
SUPERFAMILY | 15 | 93 | 79 | 1.91E-27 | ||
TIGRFAM | 17 | 99 | 83 | 1.0E-31 | ||
Pfam | 24 | 72 | 49 | 3.3E-4 | ||
ProSitePatterns | 50 | 57 | 8 | - |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
GO term | Namespace | Name | Definition | Relationships |
---|---|---|---|---|
Molecular function | RNA binding | Interacting selectively and non-covalently with an RNA molecule or a portion thereof. | ||
Molecular function | Translation elongation factor activity | Functions in chain elongation during polypeptide synthesis at the ribosome. | ||
Molecular function | Ribosome binding | Interacting selectively and non-covalently with any part of a ribosome. | ||
Biological process | Positive regulation of translational elongation | Any process that activates or increases the frequency, rate or extent of translational elongation. | ||
Biological process | Positive regulation of translational termination | Any process that activates or increases the frequency, rate or extent of translational termination. |
Expression pattern of LotjaGi4g1v0252100.5, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…