Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
| Field | Value |
|---|---|
| Gene ID | LotjaGi5g1v0314800 |
| Transcript ID | LotjaGi5g1v0314800.1 |
| Related isoforms 2 | |
| Lotus japonicus genome version | Gifu v1.2 |
| Description | Photosystem I reaction center subunit II; TAIR: AT1G03130.1 photosystem I subunit D-2; Swiss-Prot: sp|P32869|PSAD_CUCSA Photosystem I reaction center subunit II, chloroplastic; TrEMBL-Plants: tr|I3STB2|I3STB2_LOTJA Uncharacterized protein; Found in the gene: LotjaGi5g1v0314800 |
| Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr5:63293970..63294605) extracted from Lotus japonicus Gifu genome v1.2.
ATGGCAATGGCAACCCAAGCCTCCCTCTTCAGCCCACCCCTCTCTGGCCGTGTCTCCGCCCCATGGAAACAATCACCCAC CTTGTCCTTCACCAACACCAAACCCCTGAAGTTCACAACATCCCCAAGAACAACAACAACAACAATCAGAGCAGCTGATG AGAAAACAGAGGCACCAGTAGCAACAAAGGAAGCAGCACCCGTTGGGTTCACCCCACCAGAACTTGACCCAAACACACCC TCCCCAATCTTCGGAGGCAGCACTGGTGGCTTGTTGCGCAAGGCCCAGGTCGAGGAATTCTATGTTATCACATGGGAATC CCCGAAGGAACAGATCTTTGAGATGCCCACTGGCGGCGCCGCCATCATGAGGGAGGGTCCCAACCTGCTGAAATTGGCGA GGAAAGAGCAGTGTTTGGCTCTTGGGACTAGGTTGAGGTCCAAGTACAAGATCAAGTACCAATTCTACAGGGTGTTTCCT AATGGGGAGGTTCAGTATTTGCACCCTAAGGATGGTGTGTACCCTGAGAAGGTGAACCCTGGTCGCCAAGGGGTTGGACA GAACTTCAGGTCTATTGGTAAGAATGTGAGTCCTATTGAGGTTAAGTTCACTGGGAAACAACCCTATGATGTATGA
CDS sequence (LotjaGi5g1v0314800.1) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGGCAATGGCAACCCAAGCCTCCCTCTTCAGCCCACCCCTCTCTGGCCGTGTCTCCGCCCCATGGAAACAATCACCCAC CTTGTCCTTCACCAACACCAAACCCCTGAAGTTCACAACATCCCCAAGAACAACAACAACAACAATCAGAGCAGCTGATG AGAAAACAGAGGCACCAGTAGCAACAAAGGAAGCAGCACCCGTTGGGTTCACCCCACCAGAACTTGACCCAAACACACCC TCCCCAATCTTCGGAGGCAGCACTGGTGGCTTGTTGCGCAAGGCCCAGGTCGAGGAATTCTATGTTATCACATGGGAATC CCCGAAGGAACAGATCTTTGAGATGCCCACTGGCGGCGCCGCCATCATGAGGGAGGGTCCCAACCTGCTGAAATTGGCGA GGAAAGAGCAGTGTTTGGCTCTTGGGACTAGGTTGAGGTCCAAGTACAAGATCAAGTACCAATTCTACAGGGTGTTTCCT AATGGGGAGGTTCAGTATTTGCACCCTAAGGATGGTGTGTACCCTGAGAAGGTGAACCCTGGTCGCCAAGGGGTTGGACA GAACTTCAGGTCTATTGGTAAGAATGTGAGTCCTATTGAGGTTAAGTTCACTGGGAAACAACCCTATGATGTATGA
Protein sequence (LotjaGi5g1v0314800.1) extracted from Lotus japonicus Gifu v1.2 Proteins.
MAMATQASLFSPPLSGRVSAPWKQSPTLSFTNTKPLKFTTSPRTTTTTIRAADEKTEAPVATKEAAPVGFTPPELDPNTP SPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFP NGEVQYLHPKDGVYPEKVNPGRQGVGQNFRSIGKNVSPIEVKFTGKQPYDV
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
| Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
|---|---|---|---|---|---|---|
| SignalP_GRAM_POSITIVE | 1 | 19 | 19 | - | – | |
| PANTHER | 1 | 211 | 211 | 2.4E-119 | ||
| PANTHER | 1 | 211 | 211 | 2.4E-119 | – | |
| Phobius | 1 | 3 | 3 | - | – | |
| Phobius | 1 | 16 | 16 | - | – | |
| Phobius | 4 | 11 | 8 | - | – | |
| Phobius | 12 | 16 | 5 | - | – | |
| Phobius | 17 | 211 | 195 | - | – | |
| MobiDBLite | 29 | 52 | 24 | - | – | |
| MobiDBLite | 29 | 78 | 50 | - | – | |
| Gene3D | 69 | 211 | 143 | 7.3E-80 | – | |
| SUPERFAMILY | 76 | 210 | 135 | 3.53E-66 | ||
| Pfam | 79 | 209 | 131 | 1.3E-68 |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
| GO term | Namespace | Name | Definition | Relationships |
|---|---|---|---|---|
| Cellular component | Photosystem I | A photosystem that contains an iron-sulfur reaction center associated with accessory pigments and electron carriers. In cyanobacteria and chloroplasts, photosystem I functions as a light-dependent plastocyanin-ferredoxin oxidoreductase, transferring electrons from plastocyanin to ferredoxin; in photosynthetic bacteria that have only a single type I photosystem, such as the green sulfur bacteria, electrons can go either to ferredoxin (Fd) -> NAD+ or to menaquinone (MK) -> Cytb/FeS -> Cytc555 -> photosystem I (cyclic photophosphorylation). | ||
| Cellular component | Photosystem I reaction center | A photochemical system containing P700, the chlorophyll a dimer that functions as a primary electron donor. Functioning as a light-dependent plastocyanin-ferredoxin oxidoreductase, it transfers electrons from plastocyanin to ferredoxin. | ||
| Biological process | Photosynthesis | The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds. |
Expression pattern of LotjaGi5g1v0314800.1, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…