Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
| Field | Value |
|---|---|
| Gene ID | LotjaGi6g1v0261100 |
| Transcript ID | LotjaGi6g1v0261100.2 |
| Related isoforms 1 | |
| Lotus japonicus genome version | Gifu v1.2 |
| Description | ER membrane protein complex subunit 6; TAIR: AT5G49540.1 Rab5-interacting family protein; Swiss-Prot: sp|Q3ZCG8|EMC6_BOVIN ER membrane protein complex subunit 6; TrEMBL-Plants: tr|A0A151T672|A0A151T672_CAJCA Transmembrane protein 93; Found in the gene: LotjaGi6g1v0261100 |
| Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr6:57370721..57371456) extracted from Lotus japonicus Gifu genome v1.2.
ATGGCTGCACATTCCGATTCGGGTTCATCAGGGAAGAAATCAAGCAATGGAGTGAATGAGTTGCTAACTTTTAATACTGA GAATATGCAAAGCAACATGAAAATTATCTATTACAGGTTTGGTTTGACTGCAGGTTCTTAATATTATGTTGAATTTATAC ATATAGCTATAAGTATTATGTTTAGGTGGCACAGTGGACCATCAAACACCGGGGATTTTTTTTCCTTACCAGATTATAGA ACAGTGTGGGACCCCAAGTTGTTTGGGGTAGTAATTTTAGTGTAGATGGAGTTGTATAATTCTACCGGCATGAAACATTC ACTGAGTGCATAGTATATAAATATACAACACTGTCGGGGGAGGGTAGGGGGAAAACATGCAGCTCTTCAACATTGTCTAT AGTTTACAATTGATGCTTCTTTTTTTCTGTCTCTTTCGCAGACAATTGAAATTTCTTTTTTCTGTCTCTAATGCAGCCGA ACATTTTTATCTATAATTGGTGGAGTTGTTGCTGGTATTTTGGGATTTACAGCCTTGTATGGATTTGTCTTTTACTTACT TCTCATGGGAGTTACTTCGCTTGGGCTCGTTGCCAAAGCAAAATTTTCAATCCACTCATACTTCGACTCCTGGAATCGAG TGCTACTTGATGGCTTTCTGGGTGGTCTAATGGTAGGTTGTCTATGTTCGTTGCATCTTTCTTTCTGAATGATTTGTCCA TGAGAAACATCTTTAA
CDS sequence (LotjaGi6g1v0261100.2) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGGCTGCACATTCCGATTCGGGTTCATCAGGGAAGAAATCAAGCAATGGAGTGAATGAGTTGCTAACTTTTAATACTGA GAATATGCAAAGCAACATGAAAATTATCTATTACAGCCGAACATTTTTATCTATAATTGGTGGAGTTGTTGCTGGTATTT TGGGATTTACAGCCTTGTATGGATTTGTCTTTTACTTACTTCTCATGGGAGTTACTTCGCTTGGGCTCGTTGCCAAAGCA AAATTTTCAATCCACTCATACTTCGACTCCTGGAATCGAGTGCTACTTGATGGCTTTCTGGGTGGTCTAATGGTAGGTTG TCTATGTTCGTTGCATCTTTCTTTCTGA
Protein sequence (LotjaGi6g1v0261100.2) extracted from Lotus japonicus Gifu v1.2 Proteins.
MAAHSDSGSSGKKSSNGVNELLTFNTENMQSNMKIIYYSRTFLSIIGGVVAGILGFTALYGFVFYLLLMGVTSLGLVAKA KFSIHSYFDSWNRVLLDGFLGGLMVGCLCSLHLSF
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
| Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
|---|---|---|---|---|---|---|
| Phobius | 1 | 34 | 34 | - | – | |
| PANTHER | 1 | 106 | 106 | 2.0E-43 | – | |
| PANTHER | 1 | 106 | 106 | 2.0E-43 | ||
| Phobius | 35 | 56 | 22 | - | – | |
| Pfam | 36 | 104 | 69 | 4.0E-13 | ||
| TMHMM | 42 | 64 | 23 | - | – | |
| Phobius | 57 | 61 | 5 | - | – | |
| Phobius | 62 | 82 | 21 | - | – | |
| Phobius | 83 | 93 | 11 | - | – | |
| Phobius | 94 | 113 | 20 | - | – | |
| TMHMM | 94 | 113 | 20 | - | – | |
| Phobius | 114 | 115 | 2 | - | – |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
| GO term | Namespace | Name | Definition | Relationships |
|---|---|---|---|---|
| Cellular component | Endoplasmic reticulum | The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached). | ||
| Cellular component | Integral component of membrane | The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane. | ||
| Cellular component | ER membrane protein complex | A transmembrane protein complex located in the ER that is involved in ER-mitochondrial membrane tethering, which is required to facilitate lipid transfer from the ER to the mitochondrial membrane. In S. cerevisiae, it has six members: EMC1, EMC2, AIM27, EMC4, KRE27, and EMC6. |
Expression pattern of LotjaGi6g1v0261100.2, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…