Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
| Field | Value |
|---|---|
| Gene ID | LotjaGi6g1v0266600 |
| Transcript ID | LotjaGi6g1v0266600.2 |
| Related isoforms 2 | |
| Lotus japonicus genome version | Gifu v1.2 |
| Description | DNA primase/helicase; TAIR: AT1G30680.1 toprim domain-containing protein; Swiss-Prot: sp|B5X582|TWIH_ARATH Twinkle homolog protein, chloroplastic/mitochondrial; TrEMBL-Plants: tr|A0A072VFY7|A0A072VFY7_MEDTR Toprim domain protein; Found in the gene: LotjaGi6g1v0266600 |
| Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr6:58037612..58038127) extracted from Lotus japonicus Gifu genome v1.2.
GCATCTTGTAGGACTGAAACTGAATATGTGAGCCAAATGCTTACCTTAATCAAACGTTTTGCTCAACATCATGGATGCCA TGTTTGGTTTGTAGCACATCCTAGGCAGGTTGGTAACAAAAACCTCTAGCTTCATCCATTCCATTTAACATTTTTTTTTC TGATATTTTTTACTCTCATCTAATAGCTGCATAATTGGGTTGGGGGTCCTCCTAATCTCTATGATATAAGCGGAAGTGCA CACTTTATAAACAAGTGTGACAATGGAATTGTTATTCATCGTAATCGGGATCCTGAGGCTGGGGCTCTTGATCAAGTGCA GGTGATTATTTGTAGCATCATTATGCGTATTTTGTTATCATTTGTTAACATTATAAACAAAATAATTAAACACTATTGCA GTTTTGCTAACCTGGCTTTGTTTCAGGTCTGTGTTCGTAAGGTACGGAACAAGGTTGCAGGGACTATAGGTGAAGCCTTC TTGGCGTATAACAGGTACTGAGATTCTTGCCCTTGA
CDS sequence (LotjaGi6g1v0266600.2) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGCTTACCTTAATCAAACGTTTTGCTCAACATCATGGATGCCATGTTTGGTTTGTAGCACATCCTAGGCAGCTGCATAA TTGGGTTGGGGGTCCTCCTAATCTCTATGATATAAGCGGAAGTGCACACTTTATAAACAAGTGTGACAATGGAATTGTTA TTCATCGTAATCGGGATCCTGAGGCTGGGGCTCTTGATCAAGTGCAGGTCTGTGTTCGTAAGGTACGGAACAAGGTTGCA GGGACTATAGGTGAAGCCTTCTTGGCGTATAACAGGTACTGA
Protein sequence (LotjaGi6g1v0266600.2) extracted from Lotus japonicus Gifu v1.2 Proteins.
MLTLIKRFAQHHGCHVWFVAHPRQLHNWVGGPPNLYDISGSAHFINKCDNGIVIHRNRDPEAGALDQVQVCVRKVRNKVA GTIGEAFLAYNRY
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
| Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
|---|---|---|---|---|---|---|
| PANTHER | 1 | 92 | 92 | 7.2E-39 | – | |
| PANTHER | 1 | 92 | 92 | 7.2E-39 | – | |
| Gene3D | 1 | 93 | 93 | 4.2E-13 | – | |
| ProSiteProfiles | 1 | 93 | 93 | 21.505 | ||
| SUPERFAMILY | 1 | 87 | 87 | 7.08E-7 |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
| GO term | Namespace | Name | Definition | Relationships |
|---|---|---|---|---|
| Molecular function | DNA helicase activity | Catalysis of the reaction: NTP + H2O = NDP + phosphate, to drive the unwinding of a DNA helix. | ||
| Molecular function | ATP binding | Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator. | ||
| Biological process | DNA replication | The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA. |
Expression pattern of LotjaGi6g1v0266600.2, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…