Transcript — View — Lotus Base

Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi6g1v0335800.1

Overview

Field	Value
Gene ID	LotjaGi6g1v0335800
Transcript ID	LotjaGi6g1v0335800.1
Lotus japonicus genome version	Gifu v1.2
Description	Disease resistance protein (TIR-NBS-LRR class), putative; TAIR: AT1G61105.1 Toll-Interleukin-Resistance (TIR) domain family protein; Swiss-Prot: sp\|Q40392\|TMVRN_NICGU TMV resistance protein N; TrEMBL-Plants: tr\|I1KLG4\|I1KLG4_SOYBN Uncharacterized protein; Found in the gene: LotjaGi6g1v0335800
Working Lj name	n.a.

Genomic sequence (LjG1.1_chr6:65031666..65032732) extracted from Lotus japonicus Gifu genome v1.2.

AAAACAAACAAAACACAACAACAGAAACCGTTGCTTGGTACGTTACAACTGAAAACCGAAACAAACAAAACTTAAAGTAA GTATCTTCTTGAAGGAGCCATGCAGCGTTTGCCAGCAACGTTGTGCCGCAAGATCGCTCGTCCGGCATGCGAGGCGTTCA TCAGCCACCGCGGCATCGACACAAAGAGGAACGTGGCGGGGCTGCTCTACGACGGTCTCACCGGGATGGGGGTTAGGTCC TTCCTCGACAGCAAAAGCATGAAACCAGGAGACAGGCTCTTCGACCACATCGACCGAGCCATTATCGGTTGTAAGGTTGG TGTTGCTGTCTTCTCCCCTCGTTACTGCGACTCTCATTTCTGTCTCCATGAACTTGCTATGCTCATGGAGTCCAAGAAAA GGTTTGTCCCTATCTTCTACGACGTTAAGCCGTCGCAGCTTGTGGTTAAGGACAACGGAACGTGCCCGGAAAAGGAGCTT CAAAGGTTCCATTCAGCACTTGAGGAAGCTAAACTCACCGTGGGATTAACCTTTGATTCTCTCAATGGGTACGTTTTGTA CCAAGGAAAATTTAGTTCACAAATTAAAAAAAAATCCGAATTAATATTAAGCATAGTGAATTGTATTTTTTATTTTGATG GGTTTTCATTTTTCAGGGACTGGTCAGAGCTGCTTAGGGACGCGTCTGATGCCGTGATCATGAATTTGCTGGAGGTAGAA GAAGAGGAAGGAATGAAGAGTATGCAGTGAGAATCGTTCAACGGCCAATCACACAGGGATAACAATAATTGAAATTTGTT TATTCATTCATTTTACATCGCTTAATTCTTTGGTCTGAATTAATTTAATTAATTAGTTCAGGCTTCAATTCATTTGTATT AATTAATTAATCACTCAAGATTTTTTTGTTGTTGTAATTTTTGACATTTTTTTCTTCACCCAAAGCAATTCGGTTGAAGC TATACTTAGATGTGCATCTTCCATTTCCGATCCCATAATTTGGGAAATATTGTCTGTAATAGTTTCAAGGTTAAATTCAA TAAATTGTAGTTATTTGCTTTCTTCAA

Download Genomic Sequence

CDS sequence (LotjaGi6g1v0335800.1) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGCAGCGTTTGCCAGCAACGTTGTGCCGCAAGATCGCTCGTCCGGCATGCGAGGCGTTCATCAGCCACCGCGGCATCGA CACAAAGAGGAACGTGGCGGGGCTGCTCTACGACGGTCTCACCGGGATGGGGGTTAGGTCCTTCCTCGACAGCAAAAGCA TGAAACCAGGAGACAGGCTCTTCGACCACATCGACCGAGCCATTATCGGTTGTAAGGTTGGTGTTGCTGTCTTCTCCCCT CGTTACTGCGACTCTCATTTCTGTCTCCATGAACTTGCTATGCTCATGGAGTCCAAGAAAAGGTTTGTCCCTATCTTCTA CGACGTTAAGCCGTCGCAGCTTGTGGTTAAGGACAACGGAACGTGCCCGGAAAAGGAGCTTCAAAGGTTCCATTCAGCAC TTGAGGAAGCTAAACTCACCGTGGGATTAACCTTTGATTCTCTCAATGGGGACTGGTCAGAGCTGCTTAGGGACGCGTCT GATGCCGTGATCATGAATTTGCTGGAGGTAGAAGAAGAGGAAGGAATGAAGAGTATGCAGTGA

Download CDS Sequence

Protein sequence (LotjaGi6g1v0335800.1) extracted from Lotus japonicus Gifu v1.2 Proteins.

MQRLPATLCRKIARPACEAFISHRGIDTKRNVAGLLYDGLTGMGVRSFLDSKSMKPGDRLFDHIDRAIIGCKVGVAVFSP RYCDSHFCLHELAMLMESKKRFVPIFYDVKPSQLVVKDNGTCPEKELQRFHSALEEAKLTVGLTFDSLNGDWSELLRDAS DAVIMNLLEVEEEEGMKSMQ

Download Protein Sequence

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Prediction algorithm	Identifier	Start	End	Length	E-value	InterPro ID
PANTHER	PTHR31008 View details on PTHR31008 Search for proteins/transripts with this domain View external data on PTHR31008	12	177	166	5.6E-88	–
PANTHER	PTHR31008:SF19 View details on PTHR31008:SF19 Search for proteins/transripts with this domain View external data on PTHR31008:SF19	12	177	166	5.6E-88	–
SMART	SM00255 View details on SM00255 Search for proteins/transripts with this domain View external data on SM00255	16	162	147	8.9E-18	IPR000157 Show description in modal box View details on IPR000157 Search for proteins/transripts with this domain View on EBI InterPro Service
Gene3D	G3DSA:3.40.50.10140 View details on G3DSA:3.40.50.10140 Search for proteins/transripts with this domain View external data on G3DSA:3.40.50.10140	16	177	162	3.5E-31	IPR035897 Show description in modal box View details on IPR035897 Search for proteins/transripts with this domain View on EBI InterPro Service
SUPERFAMILY	SSF52200 View details on SSF52200 Search for proteins/transripts with this domain View external data on SSF52200	17	137	121	2.22E-24	IPR035897 Show description in modal box View details on IPR035897 Search for proteins/transripts with this domain View on EBI InterPro Service
ProSiteProfiles	PS50104 View details on PS50104 Search for proteins/transripts with this domain View external data on PS50104	18	162	145	14.328	IPR000157 Show description in modal box View details on IPR000157 Search for proteins/transripts with this domain View on EBI InterPro Service
Pfam	PF13676 View details on PF13676 Search for proteins/transripts with this domain View external data on PF13676	20	112	93	9.7E-16	IPR000157 Show description in modal box View details on IPR000157 Search for proteins/transripts with this domain View on EBI InterPro Service

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on April 27, 2020, while the GO metadata was last updated on April 27, 2020.

GO term	Namespace	Name	Definition	Relationships
GO:0005515 View details of GO:0005515 AmiGO InterPro QuickGO	Molecular function	Protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).	Subterm of View details of GO:0005488
GO:0007165 View details of GO:0007165 AmiGO InterPro QuickGO	Biological process	Signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.	Subterm of View details of GO:0009987 View details of GO:0050794 Part of View details of GO:0007154 View details of GO:0023052 View details of GO:0051716

Genome browser

Expression data

Expression pattern

Expression pattern of LotjaGi6g1v0335800.1, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…