Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
Field | Value |
---|---|
Gene ID | LotjaGi3g1v0008200 |
Transcript ID | LotjaGi3g1v0008200.5 |
Related isoforms 4 | |
Lotus japonicus genome version | Gifu v1.2 |
Description | Pre-mRNA-processing-splicing factor 8; TAIR: AT1G80070.1 Pre-mRNA-processing-splicing factor; Swiss-Prot: sp|Q9SSD2|PRP8A_ARATH Pre-mRNA-processing-splicing factor 8A; TrEMBL-Plants: tr|A0A151SPN6|A0A151SPN6_CAJCA Pre-mRNA-processing-splicing factor 8; Found in the gene: LotjaGi3g1v0008200 |
Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr3:930932..931396) extracted from Lotus japonicus Gifu genome v1.2.
ATGCCAAAGAACATTTTGAAGAAGTTCATTTGCATAGCAGATCTTCGAACACAAATTGCTGGGTACTTGTATGGCATAAG TCCTCCGGACAATCCTCAGGTGAAGGAAATTCGCTGCATTGTGATGACACCACAATATGGGACTCATCAACAAGTCCATC TCCCATCAGCTCTTCCAGAGCATGATTTCTTGAATGATTTGGAGCCCTTGGGATGGATGCATACTCAACCAAATGAGCTT CCCCAGTTGTCGCCTCAGGTTTGCTTGCATTAGCTTACTTATATTTTTCTTTTGTTTTTAATTAATTTCAATTAACACGA CATGGTGACGATTTTTTGAAAGTAAAATAAAAAAATTAGATTGTTGTTTTACTTATCAGGGAAATATATTTATGATTCAT GGTATACATTGTCTCACTTGAGGAATGATTATTGCAGGATCTCACTTCACATGCTAAGATCCTAG
CDS sequence (LotjaGi3g1v0008200.5) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGCCAAAGAACATTTTGAAGAAGTTCATTTGCATAGCAGATCTTCGAACACAAATTGCTGGGTACTTGTATGGCATAAG TCCTCCGGACAATCCTCAGGTGAAGGAAATTCGCTGCATTGTGATGACACCACAATATGGGACTCATCAACAAGTCCATC TCCCATCAGCTCTTCCAGAGCATGATTTCTTGAATGATTTGGAGCCCTTGGGATGGATGCATACTCAACCAAATGAGCTT CCCCAGTTGATCTCACTTCACATGCTAAGATCCTAG
Protein sequence (LotjaGi3g1v0008200.5) extracted from Lotus japonicus Gifu v1.2 Proteins.
MPKNILKKFICIADLRTQIAGYLYGISPPDNPQVKEIRCIVMTPQYGTHQQVHLPSALPEHDFLNDLEPLGWMHTQPNEL PQLISLHMLRS
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
---|---|---|---|---|---|---|
Gene3D | 1 | 90 | 90 | 8.5E-43 | – | |
PANTHER | 1 | 84 | 84 | 1.0E-44 | – | |
PANTHER | 1 | 84 | 84 | 1.0E-44 | ||
ProSiteProfiles | 1 | 91 | 91 | 12.337 | ||
Pfam | 3 | 79 | 77 | 5.7E-6 |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
GO term | Namespace | Name | Definition | Relationships |
---|---|---|---|---|
Biological process | MRNA splicing, via spliceosome | The joining together of exons from one or more primary transcripts of messenger RNA (mRNA) and the excision of intron sequences, via a spliceosomal mechanism, so that mRNA consisting only of the joined exons is produced. | ||
Molecular function | Protein binding | Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules). | ||
Cellular component | Spliceosomal complex | Any of a series of ribonucleoprotein complexes that contain snRNA(s) and small nuclear ribonucleoproteins (snRNPs), and are formed sequentially during the spliceosomal splicing of one or more substrate RNAs, and which also contain the RNA substrate(s) from the initial target RNAs of splicing, the splicing intermediate RNA(s), to the final RNA products. During cis-splicing, the initial target RNA is a single, contiguous RNA transcript, whether mRNA, snoRNA, etc., and the released products are a spliced RNA and an excised intron, generally as a lariat structure. During trans-splicing, there are two initial substrate RNAs, the spliced leader RNA and a pre-mRNA. |
Expression pattern of LotjaGi3g1v0008200.5, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…