Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
Field | Value |
---|---|
Gene ID | LotjaGi3g1v0328000 |
Transcript ID | LotjaGi3g1v0328000.2 |
Related isoforms 1 | |
Lotus japonicus genome version | Gifu v1.2 |
Description | Molybdopterin synthase sulfur carrier subunit; TAIR: AT4G10100.1 co-factor for nitrate, reductase and xanthine dehydrogenase 7; Swiss-Prot: sp|Q9S7A3|MOC2A_ARATH Molybdopterin synthase sulfur carrier subunit; TrEMBL-Plants: tr|I3T2W6|I3T2W6_LOTJA Molybdopterin synthase sulfur carrier subunit; Found in the gene: LotjaGi3g1v0328000 |
Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr3:69548447..69548758) extracted from Lotus japonicus Gifu genome v1.2.
ATGATGGAAGGAGATATTAATACTTGCGATGGAGACAACATGCACAGCAAGAAAGAAAGTGCTCTGGTGAAGATAAAAGT ATTGTTTTTCGCTAGAGCCCGTGATCTTACTGGCTTGAGTGAGGTGCCCCTGGAGGTCACATCTGGAAGTACCACTCGTG ATTGTTTGAAAAAGCTTCTTGCCCAGTTTCCGAGTTTGGAAGAAATACAAGGGTGCATGGTTTTGGCTCTGAATGAGGAG TATACAACTGAGTCAACAATTGTTAAGGACACAGATGAGTTGGCCATAATACCTCCAATAAGTGGTGGTTGA
CDS sequence (LotjaGi3g1v0328000.2) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGATGGAAGGAGATATTAATACTTGCGATGGAGACAACATGCACAGCAAGAAAGAAAGTGCTCTGGTGAAGATAAAAGT ATTGTTTTTCGCTAGAGCCCGTGATCTTACTGGCTTGAGTGAGGTGCCCCTGGAGGTCACATCTGGAAGTACCACTCGTG ATTGTTTGAAAAAGCTTCTTGCCCAGTTTCCGAGTTTGGAAGAAATACAAGGGTGCATGGTTTTGGCTCTGAATGAGGAG TATACAACTGAGTCAACAATTGTTAAGGACACAGATGAGTTGGCCATAATACCTCCAATAAGTGGTGGTTGA
Protein sequence (LotjaGi3g1v0328000.2) extracted from Lotus japonicus Gifu v1.2 Proteins.
MMEGDINTCDGDNMHSKKESALVKIKVLFFARARDLTGLSEVPLEVTSGSTTRDCLKKLLAQFPSLEEIQGCMVLALNEE YTTESTIVKDTDELAIIPPISGG
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
---|---|---|---|---|---|---|
PANTHER | 7 | 103 | 97 | 1.9E-37 | – | |
SUPERFAMILY | 23 | 101 | 79 | 1.21E-17 | ||
Gene3D | 24 | 103 | 80 | 6.8E-23 | ||
Hamap | 24 | 103 | 80 | 26.238 | ||
CDD | 25 | 103 | 79 | 1.49472E-33 | – | |
TIGRFAM | 25 | 103 | 79 | 7.9E-24 | – | |
Pfam | 27 | 103 | 77 | 1.1E-16 |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
GO term | Namespace | Name | Definition | Relationships |
---|---|---|---|---|
Cellular component | Cytosol | The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes. | ||
Biological process | Mo-molybdopterin cofactor biosynthetic process | The chemical reactions and pathways resulting in the formation of the Mo-molybdopterin cofactor, essential for the catalytic activity of some enzymes. The cofactor consists of a mononuclear molybdenum (Mo) ion coordinated by one or two molybdopterin ligands. |
Expression pattern of LotjaGi3g1v0328000.2, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…