Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi3g1v0328000.2

Overview

Field Value
Gene ID LotjaGi3g1v0328000
Transcript ID LotjaGi3g1v0328000.2
Related isoforms 1
Lotus japonicus genome version Gifu v1.2
Description Molybdopterin synthase sulfur carrier subunit; TAIR: AT4G10100.1 co-factor for nitrate, reductase and xanthine dehydrogenase 7; Swiss-Prot: sp|Q9S7A3|MOC2A_ARATH Molybdopterin synthase sulfur carrier subunit; TrEMBL-Plants: tr|I3T2W6|I3T2W6_LOTJA Molybdopterin synthase sulfur carrier subunit; Found in the gene: LotjaGi3g1v0328000
Working Lj name n.a.

Sequence information

Genomic sequence (LjG1.1_chr3:69548447..69548758) extracted from Lotus japonicus Gifu genome v1.2.

ATGATGGAAGGAGATATTAATACTTGCGATGGAGACAACATGCACAGCAAGAAAGAAAGTGCTCTGGTGAAGATAAAAGT ATTGTTTTTCGCTAGAGCCCGTGATCTTACTGGCTTGAGTGAGGTGCCCCTGGAGGTCACATCTGGAAGTACCACTCGTG ATTGTTTGAAAAAGCTTCTTGCCCAGTTTCCGAGTTTGGAAGAAATACAAGGGTGCATGGTTTTGGCTCTGAATGAGGAG TATACAACTGAGTCAACAATTGTTAAGGACACAGATGAGTTGGCCATAATACCTCCAATAAGTGGTGGTTGA 

CDS sequence (LotjaGi3g1v0328000.2) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGATGGAAGGAGATATTAATACTTGCGATGGAGACAACATGCACAGCAAGAAAGAAAGTGCTCTGGTGAAGATAAAAGT ATTGTTTTTCGCTAGAGCCCGTGATCTTACTGGCTTGAGTGAGGTGCCCCTGGAGGTCACATCTGGAAGTACCACTCGTG ATTGTTTGAAAAAGCTTCTTGCCCAGTTTCCGAGTTTGGAAGAAATACAAGGGTGCATGGTTTTGGCTCTGAATGAGGAG TATACAACTGAGTCAACAATTGTTAAGGACACAGATGAGTTGGCCATAATACCTCCAATAAGTGGTGGTTGA 

Protein sequence (LotjaGi3g1v0328000.2) extracted from Lotus japonicus Gifu v1.2 Proteins.

MMEGDINTCDGDNMHSKKESALVKIKVLFFARARDLTGLSEVPLEVTSGSTTRDCLKKLLAQFPSLEEIQGCMVLALNEE YTTESTIVKDTDELAIIPPISGG 

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Merging data from EBeye. Please wait…

Domains

Sorting

Prediction algorithm Identifier Start End Length E-value InterPro ID
PANTHER 7 103 97 1.9E-37
SUPERFAMILY 23 101 79 1.21E-17
Gene3D 24 103 80 6.8E-23
Hamap 24 103 80 26.238
CDD 25 103 79 1.49472E-33
TIGRFAM 25 103 79 7.9E-24
Pfam 27 103 77 1.1E-16

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .

GO term Namespace Name Definition Relationships
Cellular component Cytosol The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
Biological process Mo-molybdopterin cofactor biosynthetic process The chemical reactions and pathways resulting in the formation of the Mo-molybdopterin cofactor, essential for the catalytic activity of some enzymes. The cofactor consists of a mononuclear molybdenum (Mo) ion coordinated by one or two molybdopterin ligands.

Expression data

Expression pattern

Expression pattern of LotjaGi3g1v0328000.2, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…