Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
| Field | Value |
|---|---|
| Gene ID | LotjaGi1g1v0557800 |
| Transcript ID | LotjaGi1g1v0557800.10 |
| Related isoforms 9 | |
| Lotus japonicus genome version | Gifu v1.2 |
| Description | Exportin-7; TAIR: AT5G06120.1 ARM repeat superfamily protein; Swiss-Prot: sp|Q5ZLT0|XPO7_CHICK Exportin-7; TrEMBL-Plants: tr|A0A0L9UHI4|A0A0L9UHI4_PHAAN Uncharacterized protein; Found in the gene: LotjaGi1g1v0557800 |
| Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr1:109027657..109028195) extracted from Lotus japonicus Gifu genome v1.2.
ATGGAGTTGGCACAGCTAGAAGCATTGTGTGAGAGGCTGTACAATTCACAGGACTCGGTGGAACGTGCTCATGCCGAGAA CACGTTGAAATGCTTCTCAATGAACACTGAATACATTTCCCAATGCCAATACATTCTCGATCATGCTTTGACTCCCTATG CCTTGATGCTAGCTAGTTCTAGTTTGTTGAAACAAGTCACCGATCACAGCCTCGCTTTGAAACTTCGCCTTGATATATGT AACACTTGTTTTTCTTTTTCTTTTCTTTTCTGGCTTCTTCTTCAATCTTCAGTGATTCAAATTGCTGGAATTCATGGTTT TCTTGGCAATGTATGTCAGGGACCTACCTCATCAACTACCTAGCGACTAGAGGACCTGAGTTGCAGCCTTTTGTGACTGC TTCTTTGATCCAACTTCTGTGTCGACTCACGAAATTTGGATGGTTTGATGATGATCGATTTCGCGACCTGGTCAAAGAAT CTATGAACTTCTTGAGTCAGGTGATGTCAAGTGCATCTATTACTGGATTGCTGCTATAG
CDS sequence (LotjaGi1g1v0557800.10) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGGAGTTGGCACAGCTAGAAGCATTGTGTGAGAGGCTGTACAATTCACAGGACTCGGTGGAACGTGCTCATGCCGAGAA CACGTTGAAATGCTTCTCAATGAACACTGAATACATTTCCCAATGCCAATACATTCTCGATCATGCTTTGACTCCCTATG CCTTGATGCTAGCTAGTTCTAGTTTGTTGAAACAAGTCACCGATCACAGCCTCGCTTTGAAACTTCGCCTTGATATATGG ACCTACCTCATCAACTACCTAGCGACTAGAGGACCTGAGTTGCAGCCTTTTGTGACTGCTTCTTTGATCCAACTTCTGTG TCGACTCACGAAATTTGGATGGTTTGATGATGATCGATTTCGCGACCTGGTCAAAGAATCTATGAACTTCTTGAGTCAGG TGATGTCAAGTGCATCTATTACTGGATTGCTGCTATAG
Protein sequence (LotjaGi1g1v0557800.10) extracted from Lotus japonicus Gifu v1.2 Proteins.
MELAQLEALCERLYNSQDSVERAHAENTLKCFSMNTEYISQCQYILDHALTPYALMLASSSLLKQVTDHSLALKLRLDIW TYLINYLATRGPELQPFVTASLIQLLCRLTKFGWFDDDRFRDLVKESMNFLSQVMSSASITGLLL
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
| Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
|---|---|---|---|---|---|---|
| Gene3D | 1 | 145 | 145 | 2.9E-16 | ||
| SUPERFAMILY | 1 | 133 | 133 | 7.97E-14 | ||
| PANTHER | 2 | 134 | 133 | 3.4E-70 | – | |
| PANTHER | 2 | 134 | 133 | 3.4E-70 | – | |
| Coils | 3 | 23 | 21 | - | – | |
| Pfam | 25 | 88 | 64 | 1.0E-4 |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
| GO term | Namespace | Name | Definition | Relationships |
|---|---|---|---|---|
| Biological process | Intracellular protein transport | The directed movement of proteins in a cell, including the movement of proteins between specific compartments or structures within a cell, such as organelles of a eukaryotic cell. | ||
| Molecular function | Ran GTPase binding | Interacting selectively and non-covalently with Ran, a conserved Ras-like GTP-binding protein, implicated in nucleocytoplasmic transport, cell cycle progression, spindle assembly, nuclear organization and nuclear envelope (NE) assembly. |
Expression pattern of LotjaGi1g1v0557800.10, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…