Transcript — View — Lotus Base

Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi2g1v0415700.1

Overview

Field	Value
Gene ID	LotjaGi2g1v0415700
Transcript ID	LotjaGi2g1v0415700.1
Lotus japonicus genome version	Gifu v1.2
Description	Glycine cleavage system h protein; TAIR: AT1G32470.1 Single hybrid motif superfamily protein; Swiss-Prot: sp\|Q39732\|GCSH_FLAAN Glycine cleavage system H protein, mitochondrial; TrEMBL-Plants: tr\|I3SRF4\|I3SRF4_LOTJA Uncharacterized protein; Found in the gene: LotjaGi2g1v0415700
Working Lj name	n.a.

Genomic sequence (LjG1.1_chr2:91343424..91344609) extracted from Lotus japonicus Gifu genome v1.2.

ATGGCTCTGAGGATGTGGGCTTCTTCAACTGCAAATGCACTCAAACTTTCTTCCTCTGCCTCCAGGCTTCACCTTTCTCC TCCTTTTTCTCTCTCAAGATGCTTCTCTTCTGGTAACATCATCTTTCTTCACATTTAAGTTCATGTTTTGCATAATTCAC CTTACATTACATGTTTTTTTGCTGAATATGCAGTCTTGGATGGACTCAAGTACGCTTCTTCACATGAATGGGTCAAGCAT GAAGGCTCTGTAGCTACCATTGGTATCACTGATCATGCCCAGGTTCGTTTGCTTTGCTTAGCTTTGGTTTAGTTTCACAT TTTCACTTCAATTTCATTGTTGAATCAATTGCTGTGGTTGTTGTTGTTGTTGCAGGACCATCTTGGAGAGGTTGTGTTTG TGGAGCTGCCAGAATCCGGTAAGCCAGTTACTAAAGGTGACGGTTTTGGAGCAGTTGAGAGTGTTAAAGCTACAAGTGAT ATCAACTCTCCAATCTCAGGGGAGATTATTGAGGTTAACACTAAGCTCTCCGAACAACCTGGCCTGGTAATCTCAATCAA TTCTTCTAACTTTCATTCATTCATTTTACCCAATATTAATCTAGTTGTTCATTGTTATTGTTGTTTTTCTATATTTTCTT TATCAAAAGGGAAGAAAACCTCATTTACTCAAAATTTAGTATAAAATGTGCCCATGTGTAGCATTAGAATCTGTAACCGT TGACAACCAAGCGCGTAGATCAACTGGTCGGGCGGTTGTTCTAGCTTAAGCAGAGATTTCGGGTTCATGTGAATGTTCTG CGGTTGTGTTAAATACTTAGTTTTCAACCATCTATTCCTGTTTGCCTGAATTTTCTACCCAAACAAGAACAACATAGTTC TTTATACTAATTGATCTAAGAAGACTTGGTTGCAAAATTTAAGAAAAAAAAATTCAAGACCTTAATGAGGCACTACTTAT TATACATGGCTGTTTATTTTGATAGTGAACTGGATTTCACTGAATAACAGCTTATATATACATACTTATACTTATTTATC TTCTTTTGTGACATAAGATCAACACAAGCCCATACGAAGATGGATGGATGATCAAAGTGAAGCCAAGCAGTCCATCTGAA TTAGATTCCTTGTTGGGTCCACAGGAGTATACAAAATTCTGTGAGGAAGAAGATGCTGCACATTGA

Download Genomic Sequence

CDS sequence (LotjaGi2g1v0415700.1) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGGCTCTGAGGATGTGGGCTTCTTCAACTGCAAATGCACTCAAACTTTCTTCCTCTGCCTCCAGGCTTCACCTTTCTCC TCCTTTTTCTCTCTCAAGATGCTTCTCTTCTGTCTTGGATGGACTCAAGTACGCTTCTTCACATGAATGGGTCAAGCATG AAGGCTCTGTAGCTACCATTGGTATCACTGATCATGCCCAGGACCATCTTGGAGAGGTTGTGTTTGTGGAGCTGCCAGAA TCCGGTAAGCCAGTTACTAAAGGTGACGGTTTTGGAGCAGTTGAGAGTGTTAAAGCTACAAGTGATATCAACTCTCCAAT CTCAGGGGAGATTATTGAGGTTAACACTAAGCTCTCCGAACAACCTGGCCTGATCAACACAAGCCCATACGAAGATGGAT GGATGATCAAAGTGAAGCCAAGCAGTCCATCTGAATTAGATTCCTTGTTGGGTCCACAGGAGTATACAAAATTCTGTGAG GAAGAAGATGCTGCACATTGA

Download CDS Sequence

Protein sequence (LotjaGi2g1v0415700.1) extracted from Lotus japonicus Gifu v1.2 Proteins.

MALRMWASSTANALKLSSSASRLHLSPPFSLSRCFSSVLDGLKYASSHEWVKHEGSVATIGITDHAQDHLGEVVFVELPE SGKPVTKGDGFGAVESVKATSDINSPISGEIIEVNTKLSEQPGLINTSPYEDGWMIKVKPSSPSELDSLLGPQEYTKFCE EEDAAH

Download Protein Sequence

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Prediction algorithm	Identifier	Start	End	Length	E-value	InterPro ID
PANTHER	PTHR11715:SF25 View details on PTHR11715:SF25 Search for proteins/transripts with this domain View external data on PTHR11715:SF25	1	166	166	7.4E-92	–
PANTHER	PTHR11715 View details on PTHR11715 Search for proteins/transripts with this domain View external data on PTHR11715	1	166	166	7.4E-92	IPR002930 Show description in modal box View details on IPR002930 Search for proteins/transripts with this domain View on EBI InterPro Service
Gene3D	G3DSA:2.40.50.100 View details on G3DSA:2.40.50.100 Search for proteins/transripts with this domain View external data on G3DSA:2.40.50.100	36	166	131	7.0E-56	–
SUPERFAMILY	SSF51230 View details on SSF51230 Search for proteins/transripts with this domain View external data on SSF51230	38	161	124	4.58E-45	IPR011053 Show description in modal box View details on IPR011053 Search for proteins/transripts with this domain View on EBI InterPro Service
Hamap	MF_00272 View details on MF_00272 Search for proteins/transripts with this domain View external data on MF_00272	39	160	122	35.817	IPR002930 Show description in modal box View details on IPR002930 Search for proteins/transripts with this domain View on EBI InterPro Service
TIGRFAM	TIGR00527 View details on TIGR00527 Search for proteins/transripts with this domain View external data on TIGR00527	40	163	124	1.6E-46	IPR017453 Show description in modal box View details on IPR017453 Search for proteins/transripts with this domain View on EBI InterPro Service
Pfam	PF01597 View details on PF01597 Search for proteins/transripts with this domain View external data on PF01597	42	161	120	4.1E-49	IPR033753 Show description in modal box View details on IPR033753 Search for proteins/transripts with this domain View on EBI InterPro Service
CDD	cd06848 View details on cd06848 Search for proteins/transripts with this domain View external data on cd06848	44	138	95	4.39759E-52	IPR033753 Show description in modal box View details on IPR033753 Search for proteins/transripts with this domain View on EBI InterPro Service
ProSiteProfiles	PS50968 View details on PS50968 Search for proteins/transripts with this domain View external data on PS50968	57	139	83	28.381	IPR000089 Show description in modal box View details on IPR000089 Search for proteins/transripts with this domain View on EBI InterPro Service
ProSitePatterns	PS00189 View details on PS00189 Search for proteins/transripts with this domain View external data on PS00189	82	111	30	-	IPR003016 Show description in modal box View details on IPR003016 Search for proteins/transripts with this domain View on EBI InterPro Service

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on April 27, 2020, while the GO metadata was last updated on April 27, 2020.

GO term	Namespace	Name	Definition	Relationships
GO:0005960 View details of GO:0005960 AmiGO InterPro QuickGO	Cellular component	Glycine cleavage complex	A protein complex that catalyzes the reversible oxidation of glycine. In E. coli, it has four components: dihydrolipoamide dehydrogenase, glycine dehydrogenase (decarboxylating), lipoyl-GcvH-protein and aminomethyltransferase, also known as L, P, H, and T.	Subterm of View details of GO:0044444 View details of GO:1990204
GO:0019464 View details of GO:0019464 AmiGO InterPro QuickGO	Biological process	Glycine decarboxylation via glycine cleavage system	The chemical reactions and pathways resulting in the breakdown of glycine by oxidative cleavage to carbon dioxide, ammonia, and a methylene group, mediated by enzymes of the glycine cleavage complex.	Subterm of View details of GO:0006546

Genome browser

Expression data

Expression pattern

Expression pattern of LotjaGi2g1v0415700.1, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…