Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi2g1v0429600.2

Overview

Field Value
Gene ID LotjaGi2g1v0429600
Transcript ID LotjaGi2g1v0429600.2
Related isoforms 1
Lotus japonicus genome version Gifu v1.2
Description Expansin-like protein; TAIR: AT1G12560.1 expansin A7; Swiss-Prot: sp|Q8W2X8|EXP30_ORYSJ Putative expansin-A30; TrEMBL-Plants: tr|A0A0R4J4A3|A0A0R4J4A3_SOYBN Uncharacterized protein; Found in the gene: LotjaGi2g1v0429600
Working Lj name n.a.

Sequence information

Genomic sequence (LjG1.1_chr2:92670191..92670804) extracted from Lotus japonicus Gifu genome v1.2.

ATGGCCTCCATTCTTGAAGCTTGTACTCTTATGTTTCTCACTTTTACAATGACGTTGTTCTCGTTCATGGGACAGCCAGC ACTAGCTGTGGTATTTCGACCCAGTAAATGGGCTCTTGCTCATGCTACCTTTTATGGTGATGAGACTGCTTCTGAAACCA TGGGTATGTATGCATACATATATGTTAATTATCTCCATTCCTGAATTATTGAGCAATAATTCAAAATTAGTACTATTACT ATTACTTTTAACAAGTGATGCTTAGCATTAACATACTTTTATTTGGACTTAAAGGAGGAGCATGTGGGTACGGGAATTTG TTTCAGAGCGGTTACGGGACAGATACAGTGGCTTTAAGCTCGACGCTATTTAACAATGGTTATGCGTGTGGGACTTGTTA CCAGATAAAATGTTACCAGTCCAGTGCATGCTATAAAAACGTGGCCTTCACCACTGTCACCGCCACCAATCTCTGCCCTC CTAATTGGTCCAAGCCCTCAGATAACGGCGGCTGGTGCAACCCTCCCCGAGCGCATTTCGACATGTCCAAGCCCGCCTTC ATGAAAATCGCTCAGTGGAAAGCCGGCATTGTCCCTGTCCTGTTCCGCAGGTAA 

CDS sequence (LotjaGi2g1v0429600.2) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGGCCTCCATTCTTGAAGCTTGTACTCTTATGTTTCTCACTTTTACAATGACGTTGTTCTCGTTCATGGGACAGCCAGC ACTAGCTGTGGTATTTCGACCCAGTAAATGGGCTCTTGCTCATGCTACCTTTTATGGTGATGAGACTGCTTCTGAAACCA TGGGAGGAGCATGTGGGTACGGGAATTTGTTTCAGAGCGGTTACGGGACAGATACAGTGGCTTTAAGCTCGACGCTATTT AACAATGGTTATGCGTGTGGGACTTGTTACCAGATAAAATGTTACCAGTCCAGTGCATGCTATAAAAACGTGGCCTTCAC CACTGTCACCGCCACCAATCTCTGCCCTCCTAATTGGTCCAAGCCCTCAGATAACGGCGGCTGGTGCAACCCTCCCCGAG CGCATTTCGACATGTCCAAGCCCGCCTTCATGAAAATCGCTCAGTGGAAAGCCGGCATTGTCCCTGTCCTGTTCCGCAGG TAA 

Protein sequence (LotjaGi2g1v0429600.2) extracted from Lotus japonicus Gifu v1.2 Proteins.

MASILEACTLMFLTFTMTLFSFMGQPALAVVFRPSKWALAHATFYGDETASETMGGACGYGNLFQSGYGTDTVALSSTLF NNGYACGTCYQIKCYQSSACYKNVAFTTVTATNLCPPNWSKPSDNGGWCNPPRAHFDMSKPAFMKIAQWKAGIVPVLFRR 

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Merging data from EBeye. Please wait…

Domains

Sorting

Prediction algorithm Identifier Start End Length E-value InterPro ID
PANTHER 1 160 160 2.3E-83
Phobius 1 29 29 -
Phobius 1 6 6 -
PANTHER 1 160 160 2.3E-83
SignalP_EUK 1 29 29 -
Phobius 7 20 14 -
TMHMM 10 32 23 -
Phobius 21 29 9 -
Gene3D 28 160 133 1.9E-38
Phobius 30 160 131 -
PRINTS 36 51 16 1.4E-27
SUPERFAMILY 36 160 125 6.63E-41
PRINTS 54 72 19 1.4E-27
ProSiteProfiles 55 160 106 26.446
PRINTS 67 81 15 2.6E-28
SMART 72 158 87 5.1E-47
Pfam 72 157 86 2.1E-22
PRINTS 76 94 19 1.4E-27
PRINTS 107 117 11 2.6E-28
PRINTS 126 143 18 2.6E-28
PRINTS 143 156 14 2.6E-28
PRINTS 151 160 10 1.4E-27

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .

GO term Namespace Name Definition Relationships
Cellular component Extracellular region The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
Biological process Plant-type cell wall organization A process that results in the assembly and arrangement of constituent parts of the cellulose and pectin-containing cell wall, or in the disassembly of the cellulose and pectin-containing cell wall. This process is carried out at the cellular level. An example of this process is found in Arabidopsis thaliana.

Expression data

Expression pattern

Expression pattern of LotjaGi2g1v0429600.2, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…