Transcript — View — Lotus Base

Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi3g1v0047700.1

Overview

Field	Value
Gene ID	LotjaGi3g1v0047700
Transcript ID	LotjaGi3g1v0047700.1
Lotus japonicus genome version	Gifu v1.2
Description	Translation initiation factor IF-1; TAIR: AT4G11175.1 Nucleic acid-binding, OB-fold-like protein; Swiss-Prot: sp\|Q94KR7\|IF1C_SOYBN Translation initiation factor IF-1, chloroplastic; TrEMBL-Plants: tr\|G7LDQ8\|G7LDQ8_MEDTR Translation initiation factor IF-1; Found in the gene: LotjaGi3g1v0047700
Working Lj name	n.a.

Genomic sequence (LjG1.1_chr3:5067382..5068924) extracted from Lotus japonicus Gifu genome v1.2.

CAAGCATGGGTATATATTTCCCAAAACCTTATCCCACCCAAATATCCCCATTTTCTTCAACAACACAAACTGAGAAAGAA ACTGCAAAACCTTCATCATCACACATTCACACCACAAGTGAAGAGACATGTTCACCTCATCATCTCTCTTCTCATTCCAC ACTCCAACTCCAACCCTTCATCATCATCATAATCTCATTCCCTTAACCACCACCACACACTCCTTTCGCTTTCTTCAACC ACTCAACCACCCTCTCTCCCTCTCCCACTCGCCGGCGCCCTTCTCCGCCGCCGCCAAGCCACCCACCGCCGACAAGTCCA GCGAGCAGAAATGGGTCCACGAGGGTCTCATCACTGAGTCCCTCCCCAACGGCATGTTCCGTGTCCGCCTCGACAACGAG GACCTTATCCTCGGCTATGTCTCCGGCAAGATCCGGAAGAACTTCGTTCGGATCCTTCCCGGCGACAGGGTCAAAGTTGA GGTCAGTCGCTATGATTCTTCCAAAGGACGCATAGTTTACAGGCTCCGTAACACCGGTGGTGGCTCCTCTTAGCTTTCAT GCACGTGAGGTGTTTGTGAAAATGTCTCAGACAACCCTCCAATTGGGTACTCTTCTTTTGTAATAGCTTTTCTTTGATGG GGAAGGGAAAGGGTATTAGAGACTCCATAGTTGTACTCCATGGTTGTATAAAGAAGAATCATTTGGGTCTATTTTTTTTT GTTCAGTTTCACCTTATAATTGATGCATTTTCTGTAGTGGTTGTAGTGAGTGCATTTGATTTTAACCTCCTATGATGTGC ATGTCTTTGGTAAAATGATCAGTTGATTTTTGTTTTATTATGACATTTTGACATCAATTGATCAATGCAATCTAGACCAG CTAAGTATAAAGAGTAGGGTGTTCCCCCTTGAGATTGTGTCATTTCACATTGATTTGTCTGCATTTCTGAAACTCTTGGT ATTGATTGAGCCATGTTAAGACTTGCCATCTGATGAGAATTTCATGGGTAATGTTTGATTTTCTGTCAGTGGTTTAGGGA GGAAGAAGTGAATCAAGTGATATTGAATTAAGTGGCAAGGAATTGAATGTAGTAAGTGGCAAAGAATTCTATAGTTAGAA TGAATTTAACTTCTATGTGTGGCAGCAATTATTAGGTACCACCTTCTATTCACTTTGACAAGCACAAGAGTTTGGTAATT GACACACCTATAGCTGCTTAAAGAATTAGTGGTATTTGTTATCAAGGTGGATCCGGACTTTCTACTTTTACCTCTTTCCA TGTCCTCATTTTCTTCTTCTGCCATCACAATCCCTTACACCATTCATCATGCTGTGATAGTCCCTGAATCATGTATCACC GCAGCTGTTAAACACAACTCCTTCTGACTATCATCAATCTTTGAATGGTAAGTGGTCAACATGATTTTGTTGATTTCCAA GTACAGGACTATCTATACAAATGGTCAGGTTTCTAGAATCAATCAATTTTTTTGGCTGCACTGCATCACTGTATCAGGTG TAAGCTACAGAACCGAGCTTGAA

Download Genomic Sequence

CDS sequence (LotjaGi3g1v0047700.1) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGTTCACCTCATCATCTCTCTTCTCATTCCACACTCCAACTCCAACCCTTCATCATCATCATAATCTCATTCCCTTAAC CACCACCACACACTCCTTTCGCTTTCTTCAACCACTCAACCACCCTCTCTCCCTCTCCCACTCGCCGGCGCCCTTCTCCG CCGCCGCCAAGCCACCCACCGCCGACAAGTCCAGCGAGCAGAAATGGGTCCACGAGGGTCTCATCACTGAGTCCCTCCCC AACGGCATGTTCCGTGTCCGCCTCGACAACGAGGACCTTATCCTCGGCTATGTCTCCGGCAAGATCCGGAAGAACTTCGT TCGGATCCTTCCCGGCGACAGGGTCAAAGTTGAGGTCAGTCGCTATGATTCTTCCAAAGGACGCATAGTTTACAGGCTCC GTAACACCGGTGGTGGCTCCTCTTAG

Download CDS Sequence

Protein sequence (LotjaGi3g1v0047700.1) extracted from Lotus japonicus Gifu v1.2 Proteins.

MFTSSSLFSFHTPTPTLHHHHNLIPLTTTTHSFRFLQPLNHPLSLSHSPAPFSAAAKPPTADKSSEQKWVHEGLITESLP NGMFRVRLDNEDLILGYVSGKIRKNFVRILPGDRVKVEVSRYDSSKGRIVYRLRNTGGGSS

Download Protein Sequence

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Prediction algorithm	Identifier	Start	End	Length	E-value	InterPro ID
PANTHER	PTHR33370 View details on PTHR33370 Search for proteins/transripts with this domain View external data on PTHR33370	21	136	116	1.7E-43	IPR004368 Show description in modal box View details on IPR004368 Search for proteins/transripts with this domain View on EBI InterPro Service
PANTHER	PTHR33370:SF1 View details on PTHR33370:SF1 Search for proteins/transripts with this domain View external data on PTHR33370:SF1	21	136	116	1.7E-43	–
Gene3D	G3DSA:2.40.50.140 View details on G3DSA:2.40.50.140 Search for proteins/transripts with this domain View external data on G3DSA:2.40.50.140	57	134	78	4.9E-31	–
Hamap	MF_00075 View details on MF_00075 Search for proteins/transripts with this domain View external data on MF_00075	63	134	72	22.627	IPR004368 Show description in modal box View details on IPR004368 Search for proteins/transripts with this domain View on EBI InterPro Service
TIGRFAM	TIGR00008 View details on TIGR00008 Search for proteins/transripts with this domain View external data on TIGR00008	66	133	68	1.6E-34	IPR004368 Show description in modal box View details on IPR004368 Search for proteins/transripts with this domain View on EBI InterPro Service
SUPERFAMILY	SSF50249 View details on SSF50249 Search for proteins/transripts with this domain View external data on SSF50249	66	132	67	1.39E-22	IPR012340 Show description in modal box View details on IPR012340 Search for proteins/transripts with this domain View on EBI InterPro Service
SMART	SM00316 View details on SM00316 Search for proteins/transripts with this domain View external data on SM00316	66	134	69	2.5E-4	IPR022967 Show description in modal box View details on IPR022967 Search for proteins/transripts with this domain View on EBI InterPro Service
CDD	cd04451 View details on cd04451 Search for proteins/transripts with this domain View external data on cd04451	72	132	61	6.28374E-34	IPR004368 Show description in modal box View details on IPR004368 Search for proteins/transripts with this domain View on EBI InterPro Service
Pfam	PF01176 View details on PF01176 Search for proteins/transripts with this domain View external data on PF01176	72	132	61	8.3E-21	IPR006196 Show description in modal box View details on IPR006196 Search for proteins/transripts with this domain View on EBI InterPro Service
ProSiteProfiles	PS50832 View details on PS50832 Search for proteins/transripts with this domain View external data on PS50832	72	134	63	19.849	IPR006196 Show description in modal box View details on IPR006196 Search for proteins/transripts with this domain View on EBI InterPro Service

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on April 27, 2020, while the GO metadata was last updated on April 27, 2020.

GO term	Namespace	Name	Definition	Relationships
GO:0003723 View details of GO:0003723 AmiGO InterPro QuickGO	Molecular function	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.	Subterm of View details of GO:0003676
GO:0003743 View details of GO:0003743 AmiGO InterPro QuickGO	Molecular function	Translation initiation factor activity	Functions in the initiation of ribosome-mediated translation of mRNA into a polypeptide.	Subterm of View details of GO:0008135
GO:0006413 View details of GO:0006413 AmiGO InterPro QuickGO	Biological process	Translational initiation	The process preceding formation of the peptide bond between the first two amino acids of a protein. This includes the formation of a complex of the ribosome, mRNA or circRNA, and an initiation complex that contains the first aminoacyl-tRNA.	Subterm of View details of GO:0044237 Part of View details of GO:0006412

Genome browser

Expression data

Expression pattern

Expression pattern of LotjaGi3g1v0047700.1, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…