Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi3g1v0068100.2

Overview

Field Value
Gene ID LotjaGi3g1v0068100
Transcript ID LotjaGi3g1v0068100.2
Related isoforms 2
Lotus japonicus genome version Gifu v1.2
Description Protein mago nashi like; TAIR: AT1G02140.1 mago nashi family protein; Swiss-Prot: sp|O23676|MGN_ARATH Protein mago nashi homolog; TrEMBL-Plants: tr|I3RZM3|I3RZM3_LOTJA Uncharacterized protein; Found in the gene: LotjaGi3g1v0068100
Working Lj name n.a.

Sequence information

Genomic sequence (LjG1.1_chr3:7424190..7424847) extracted from Lotus japonicus Gifu genome v1.2.

ATGGCGACCGAAGAAGAGAACGCAGAATTCTACCTTCGATACTACGTCGGACACAAGGGGAAGTTCGGCCACGAGTTCTT GGAATTCGAGTTCCGACCCGACGGCAAGCTCCGCTACGCCAACAACTCCAACTACAAAAACGACACCATCATCCGCAAAG AAGTTTACCTAACCCCCGCCGTCCTCCGCGAGTGCCGCCGCATCATCGCCGAGAGCGAGGTCGGTCACCAAACCCTAACT CGCCGCCAAACGGTGTCGTATCCTGTTGCTGTTGTTGTTGTTCTCATTTGTGTTTGTGTTGCAGATCATGAAGGAAGATG ATAATAACTGGCCGGAGCCTGACCGGGTTGGGAGGCAGGAGCTTGAGATTGTGATGGGGAATGAGCATATCTCGTTTACC ACTTCCAAGATTGGGTCTCTGGTGGATGTTCAGAGCAGTGCTGATCCTGAAGGGCTTCGCATTTTCTACTATCTTGTTCA GGTGAGCTTTATTCGGTGCTTGCAAAATGTTTTTGATGAATTTTCTGAGCTAGAATTAAGGAGAATGCAATTATAAGGAA AATTATATGATTGTGTTTTGCTCCATTCGCATGAATTTGAAGATTATGAAATTAGGGTTTAAGCTATGACTAAGGTGCAT TTGGAAGACCTATTTTAG 

CDS sequence (LotjaGi3g1v0068100.2) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGGCGACCGAAGAAGAGAACGCAGAATTCTACCTTCGATACTACGTCGGACACAAGGGGAAGTTCGGCCACGAGTTCTT GGAATTCGAGTTCCGACCCGACGGCAAGCTCCGCTACGCCAACAACTCCAACTACAAAAACGACACCATCATCCGCAAAG AAGTTTACCTAACCCCCGCCGTCCTCCGCGAGTGCCGCCGCATCATCGCCGAGAGCGAGATCATGAAGGAAGATGATAAT AACTGGCCGGAGCCTGACCGGGTTGGGAGGCAGGAGCTTGAGATTGTGATGGGGAATGAGCATATCTCGTTTACCACTTC CAAGATTGGGTCTCTGGTGGATGTTCAGAGCAGTGCTGATCCTGAAGGGCTTCGCATTTTCTACTATCTTGTTCAGATTA TGAAATTAGGGTTTAAGCTATGA 

Protein sequence (LotjaGi3g1v0068100.2) extracted from Lotus japonicus Gifu v1.2 Proteins.

MATEEENAEFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDTIIRKEVYLTPAVLRECRRIIAESEIMKEDDN NWPEPDRVGRQELEIVMGNEHISFTTSKIGSLVDVQSSADPEGLRIFYYLVQIMKLGFKL 

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Merging data from EBeye. Please wait…

Domains

Sorting

Prediction algorithm Identifier Start End Length E-value InterPro ID
PANTHER 4 135 132 2.8E-84
PANTHER 4 135 132 2.8E-84
Gene3D 5 140 136 8.0E-71
CDD 9 135 127 1.22482E-97
SUPERFAMILY 9 135 127 6.28E-65
Pfam 10 135 126 1.0E-66

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .

GO term Namespace Name Definition Relationships
Cellular component Nucleus A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
Biological process RNA splicing The process of removing sections of the primary RNA transcript to remove sequences not present in the mature form of the RNA and joining the remaining sections to form the mature form of the RNA.
Cellular component Exon-exon junction complex A multi-subunit complex deposited by the spliceosome upstream of messenger RNA exon-exon junctions. The exon-exon junction complex provides a binding platform for factors involved in mRNA export and nonsense-mediated mRNA decay.

Expression data

Expression pattern

Expression pattern of LotjaGi3g1v0068100.2, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…