Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi3g1v0248200.2

Overview

Field Value
Gene ID LotjaGi3g1v0248200
Transcript ID LotjaGi3g1v0248200.2
Related isoforms 1
Lotus japonicus genome version Gifu v1.2
Description PHD finger-like domain-containing protein 5A; TAIR: AT1G07170.1 PHF5-like protein; Swiss-Prot: sp|P0DI19|PHF5A_ARATH PHD finger-like domain-containing protein 5A; TrEMBL-Plants: tr|M8CB49|M8CB49_AEGTA Zinc finger CCCH domain-containing protein 30; Found in the gene: LotjaGi3g1v0248200
Working Lj name n.a.

Sequence information

Genomic sequence (LjG1.1_chr3:41191045..41191377) extracted from Lotus japonicus Gifu genome v1.2.

ATGGCCAAGCATCATCCTGATTTGATTATGTGTCGGAAGCAACCTGGCATCGCCATTGGACGATTGTGTGAAAAATGCGA TGGCAAGTGTGTGATATGCGACTCATATGTGCGTCCTTGTACACTAGTCCGGGTTTGTGATGAGTGCAACTATGGATCAT TTCAAGGTCGATGTGTGATATGTGGAGGAGTAGGAATATCTGATGCTTACTACTGCAAGGAGTGCACACAACAAGAGAAA GACAGGGATGGTTGCCCCAAAATTGTCAATTTAGGGAGTGCCAAAACTGATTTATTCTATGAACGCAAAAAGTATGGTTT TAAGAAAAGATGA 

CDS sequence (LotjaGi3g1v0248200.2) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGGCCAAGCATCATCCTGATTTGATTATGTGTCGGAAGCAACCTGGCATCGCCATTGGACGATTGTGTGAAAAATGCGA TGGCAAGTGTGTGATATGCGACTCATATGTGCGTCCTTGTACACTAGTCCGGGTTTGTGATGAGTGCAACTATGGATCAT TTCAAGGTCGATGTGTGATATGTGGAGGAGTAGGAATATCTGATGCTTACTACTGCAAGGAGTGCACACAACAAGAGAAA GACAGGGATGGTTGCCCCAAAATTGTCAATTTAGGGAGTGCCAAAACTGATTTATTCTATGAACGCAAAAAGTATGGTTT TAAGAAAAGATGA 

Protein sequence (LotjaGi3g1v0248200.2) extracted from Lotus japonicus Gifu v1.2 Proteins.

MAKHHPDLIMCRKQPGIAIGRLCEKCDGKCVICDSYVRPCTLVRVCDECNYGSFQGRCVICGGVGISDAYYCKECTQQEK DRDGCPKIVNLGSAKTDLFYERKKYGFKKR 

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Merging data from EBeye. Please wait…

Domains

Sorting

Prediction algorithm Identifier Start End Length E-value InterPro ID
PANTHER 1 110 110 8.2E-76
PIRSF 1 110 110 1.2E-51
Pfam 1 104 104 2.4E-50
PANTHER 1 110 110 8.2E-76

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .

GO term Namespace Name Definition Relationships
Biological process MRNA splicing, via spliceosome The joining together of exons from one or more primary transcripts of messenger RNA (mRNA) and the excision of intron sequences, via a spliceosomal mechanism, so that mRNA consisting only of the joined exons is produced.

Expression data

Expression pattern

Expression pattern of LotjaGi3g1v0248200.2, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…