Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
Field | Value |
---|---|
Gene ID | LotjaGi3g1v0475300 |
Transcript ID | LotjaGi3g1v0475300.2 |
Related isoforms 4 | |
Lotus japonicus genome version | Gifu v1.2 |
Description | Vesicle-associated membrane protein, putative; TAIR: AT5G22360.1 vesicle-associated membrane protein 714; Swiss-Prot: sp|Q9FMR5|VA714_ARATH Vesicle-associated membrane protein 714; TrEMBL-Plants: tr|B7FI29|B7FI29_MEDTR Synaptobrevin-like protein; Found in the gene: LotjaGi3g1v0475300 |
Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr3:89205202..89205611) extracted from Lotus japonicus Gifu genome v1.2.
ATGGTGGACAATATTGAGAAAATATTGGAGAGAGGTGACCGGATTGAGCTTCTCGTTGATAAGACAGCAACAATGCAAGA CAATTCATTTCACTTTAGGAAACAGTCAAAGCGCCTTCGAAGAGCGCTATGGATGAAAAATTTCAAGCTCCTGTGAGTAA ATTTTCTTTGATATGCTGAATATAAATAATATATATTTCAAAAGTATTCATTTTAGATATGGGGTACCTGAAGTTGTTTA TATTTATCTTGGAATGCAACAATGGGCTTATTGCTCTTCTATCCTTGTCTTGACTTGATGTTTTTTTGGTCTTTGACAGC GCATTATTGACATGCTTGATTGTTCTCATTCTTTACTTCATAATCGCTGCTTGTTGCGGAGGCATCACTCTACCATCCTG CAGATCCTAA
CDS sequence (LotjaGi3g1v0475300.2) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGGTGGACAATATTGAGAAAATATTGGAGAGAGGTGACCGGATTGAGCTTCTCGTTGATAAGACAGCAACAATGCAAGA CAATTCATTTCACTTTAGGAAACAGTCAAAGCGCCTTCGAAGAGCGCTATGGATGAAAAATTTCAAGCTCCTCGCATTAT TGACATGCTTGATTGTTCTCATTCTTTACTTCATAATCGCTGCTTGTTGCGGAGGCATCACTCTACCATCCTGCAGATCC TAA
Protein sequence (LotjaGi3g1v0475300.2) extracted from Lotus japonicus Gifu v1.2 Proteins.
MVDNIEKILERGDRIELLVDKTATMQDNSFHFRKQSKRLRRALWMKNFKLLALLTCLIVLILYFIIAACCGGITLPSCRS
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
---|---|---|---|---|---|---|
Gene3D | 1 | 70 | 70 | 2.6E-21 | – | |
Pfam | 1 | 71 | 71 | 9.4E-26 | ||
CDD | 1 | 44 | 44 | 6.16798E-21 | – | |
ProSiteProfiles | 1 | 46 | 46 | 14.701 | ||
PANTHER | 1 | 71 | 71 | 1.3E-27 | – | |
SUPERFAMILY | 1 | 48 | 48 | 1.57E-15 | – | |
Phobius | 1 | 49 | 49 | - | – | |
PANTHER | 1 | 71 | 71 | 1.3E-27 | – | |
ProSitePatterns | 4 | 23 | 20 | - | ||
PRINTS | 11 | 30 | 20 | 5.0E-6 | ||
PRINTS | 47 | 66 | 20 | 5.0E-6 | ||
Phobius | 50 | 75 | 26 | - | – | |
TMHMM | 50 | 75 | 26 | - | – | |
Phobius | 76 | 80 | 5 | - | – |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
GO term | Namespace | Name | Definition | Relationships |
---|---|---|---|---|
Cellular component | Integral component of membrane | The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane. | ||
Biological process | Vesicle-mediated transport | A cellular transport process in which transported substances are moved in membrane-bounded vesicles; transported substances are enclosed in the vesicle lumen or located in the vesicle membrane. The process begins with a step that directs a substance to the forming vesicle, and includes vesicle budding and coating. Vesicles are then targeted to, and fuse with, an acceptor membrane. |
Expression pattern of LotjaGi3g1v0475300.2, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…