Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
| Field | Value |
|---|---|
| Gene ID | LotjaGi3g1v0521900 |
| Transcript ID | LotjaGi3g1v0521900.2 |
| Related isoforms 1 | |
| Lotus japonicus genome version | Gifu v1.2 |
| Description | Actin-depolymerizing factor; TAIR: AT2G16700.1 actin depolymerizing factor 5; Swiss-Prot: sp|Q9ZNT3|ADF5_ARATH Actin-depolymerizing factor 5; TrEMBL-Plants: tr|I3S730|I3S730_LOTJA Uncharacterized protein; Found in the gene: LotjaGi3g1v0521900 |
| Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr3:93853872..93854518) extracted from Lotus japonicus Gifu genome v1.2.
ATGTGGGTGACGGATGAGTGCAAGAACTCGTTCATGGAGATGAAGTGGAAGAAGGTCCACAGGTACATAGTCTTCAAGAT CGACGAGAGGTCCCGTCTTGTTACTGTCGACAAGGTGGGTGGTCCCGGCGAGAGCTACGCCGATCTCGCCGCCTCCTTGC CCGGCGATGACTGCAGATACGCCGTCTTCGACTTCGATTTCGTCACCGTCGATAACTGCCGCAAGAGCAAGATCTTCTTC ATCGCATGGTATGATTATGATATAAATTTGTCAAACCCACAAGGTGCTTGTGTAATTGTCTGTGAGAGTGTGAATGACTC TGATACTAGTAATGTTGTTGAGAAAAATGGTTTGGGAAAGTGACCCATTACCCAGATGAGAACTAAAAGTTAATTTTTAG GTGAAATTGGTGTGTATGAATATGGAGATTGATGTGGATTGTGATTTGTGAAGAAGGGGTTATTGATTTTTAGGAAATTT TGTTTGTTTTTTTCAGGTCTCCAACAGCATCAAGGATAAGAGCTAAGATTCTATACGCAACATCCAAAGATGGGTTGAGA AGAGCTCTTGATGGAATCAGCTATGAACTTCAGGCCACTGATCCAACTGAGATGGGATTTGATGTAATTCAAGACAGAGC CAAGTAG
CDS sequence (LotjaGi3g1v0521900.2) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGTGGGTGACGGATGAGTGCAAGAACTCGTTCATGGAGATGAAGTGGAAGAAGGTCCACAGGTACATAGTCTTCAAGAT CGACGAGAGGTCCCGTCTTGTTACTGTCGACAAGGTGGGTGGTCCCGGCGAGAGCTACGCCGATCTCGCCGCCTCCTTGC CCGGCGATGACTGCAGATACGCCGTCTTCGACTTCGATTTCGTCACCGTCGATAACTGCCGCAAGAGCAAGATCTTCTTC ATCGCATGGTCTCCAACAGCATCAAGGATAAGAGCTAAGATTCTATACGCAACATCCAAAGATGGGTTGAGAAGAGCTCT TGATGGAATCAGCTATGAACTTCAGGCCACTGATCCAACTGAGATGGGATTTGATGTAATTCAAGACAGAGCCAAGTAG
Protein sequence (LotjaGi3g1v0521900.2) extracted from Lotus japonicus Gifu v1.2 Proteins.
MWVTDECKNSFMEMKWKKVHRYIVFKIDERSRLVTVDKVGGPGESYADLAASLPGDDCRYAVFDFDFVTVDNCRKSKIFF IAWSPTASRIRAKILYATSKDGLRRALDGISYELQATDPTEMGFDVIQDRAK
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
| Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
|---|---|---|---|---|---|---|
| SUPERFAMILY | 1 | 130 | 130 | 1.58E-40 | – | |
| PANTHER | 1 | 132 | 132 | 9.4E-92 | – | |
| ProSiteProfiles | 1 | 132 | 132 | 34.342 | ||
| PANTHER | 1 | 132 | 132 | 9.4E-92 | ||
| Gene3D | 1 | 132 | 132 | 4.6E-41 | ||
| CDD | 3 | 131 | 129 | 3.84113E-59 | ||
| SMART | 5 | 132 | 128 | 2.4E-47 | ||
| Pfam | 7 | 129 | 123 | 9.0E-32 |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
| GO term | Namespace | Name | Definition | Relationships |
|---|---|---|---|---|
| Molecular function | Actin binding | Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments. | ||
| Cellular component | Actin cytoskeleton | The part of the cytoskeleton (the internal framework of a cell) composed of actin and associated proteins. Includes actin cytoskeleton-associated complexes. | ||
| Biological process | Actin filament depolymerization | Disassembly of actin filaments by the removal of actin monomers from a filament. |
Expression pattern of LotjaGi3g1v0521900.2, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…