Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
Field | Value |
---|---|
Gene ID | LotjaGi5g1v0074500 |
Transcript ID | LotjaGi5g1v0074500.3 |
Related isoforms 2 | |
Lotus japonicus genome version | Gifu v1.2 |
Description | Nuclear transcription factor Y subunit B; TAIR: AT2G37060.1 nuclear factor Y, subunit B8; Swiss-Prot: sp|Q8VYK4|NFYB8_ARATH Nuclear transcription factor Y subunit B-8; TrEMBL-Plants: tr|A0A1J7GR83|A0A1J7GR83_LUPAN Uncharacterized protein; Found in the gene: LotjaGi5g1v0074500 |
Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr5:12353635..12354270) extracted from Lotus japonicus Gifu genome v1.2.
CAGGTAACAACACCACTTCACAGTTCACACTTCACTATTCTATTCACACCCTCTTCTTCCTCATGTTTCTTCTACGATTA GGGTTCCGCCGACCATGGCCGATGCTCCGGCGAGTCCTCCCGACGAGAGCGGCGACCACAGCCCCCGCTCCAGCTTCCGT GAGCAGGATCGTTTCCTTCCTGTTGCTAACATCAGCCGCATCATGAAGAAGGGACTTCCTGCTAATGGCAAAATCGCTAA GGACGCCAAGGAGACTGTCCAGGAGTGTGTCTCTGAGTTCATCAGCTTCGTCACCAGCGAGTAAGCTTCTTCTCTTCATG ATTCCCCTATTGTGATTCCTCAGAATAATCATGTTCATGGTTCACAGGGCGAGTGATAAATGCCAGAGAGAGAAGAGGAA GACTATCAACGGCGACGATTTGCTCTGGGCAATGGCCACTCTGGGTTTTGAAGAGTACATTGATCCACTCAAGCTTTACC TAGCTGCATACAGAGAGGTGATTTTGAATTTACAATTTTTTTTAATTTCTATGGACTGTTGTTCGTACATAGTTGAATAT TCAGCTTCTGGTATTTGGTATTTATGGTACAGCGTGTTGATTTGGTTTGCTGCAGTTAATTTCCAATTTTCACTGA
CDS sequence (LotjaGi5g1v0074500.3) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGGCCGATGCTCCGGCGAGTCCTCCCGACGAGAGCGGCGACCACAGCCCCCGCTCCAGCTTCCGTGAGCAGGATCGTTT CCTTCCTGTTGCTAACATCAGCCGCATCATGAAGAAGGGACTTCCTGCTAATGGCAAAATCGCTAAGGACGCCAAGGAGA CTGTCCAGGAGTGTGTCTCTGAGTTCATCAGCTTCGTCACCAGCGAGGCGAGTGATAAATGCCAGAGAGAGAAGAGGAAG ACTATCAACGGCGACGATTTGCTCTGGGCAATGGCCACTCTGGGTTTTGAAGAGTACATTGATCCACTCAAGCTTTACCT AGCTGCATACAGAGAGTTAATTTCCAATTTTCACTGA
Protein sequence (LotjaGi5g1v0074500.3) extracted from Lotus japonicus Gifu v1.2 Proteins.
MADAPASPPDESGDHSPRSSFREQDRFLPVANISRIMKKGLPANGKIAKDAKETVQECVSEFISFVTSEASDKCQREKRK TINGDDLLWAMATLGFEEYIDPLKLYLAAYRELISNFH
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
---|---|---|---|---|---|---|
MobiDBLite | 1 | 24 | 24 | - | – | |
PANTHER | 5 | 112 | 108 | 2.1E-67 | – | |
PANTHER | 5 | 112 | 108 | 2.1E-67 | – | |
Gene3D | 17 | 116 | 100 | 1.6E-42 | ||
SUPERFAMILY | 24 | 114 | 91 | 5.12E-38 | ||
Pfam | 27 | 91 | 65 | 9.7E-28 | ||
PRINTS | 55 | 73 | 19 | 3.0E-20 | – | |
ProSitePatterns | 58 | 74 | 17 | - | ||
PRINTS | 74 | 92 | 19 | 3.0E-20 | – | |
PRINTS | 93 | 111 | 19 | 3.0E-20 | – |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
GO term | Namespace | Name | Definition | Relationships |
---|---|---|---|---|
Cellular component | Nucleus | A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent. | ||
Biological process | Regulation of transcription, DNA-templated | Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription. | ||
Molecular function | Sequence-specific DNA binding | Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding. | ||
Molecular function | Protein heterodimerization activity | Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer. |
Expression pattern of LotjaGi5g1v0074500.3, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…