Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
Field | Value |
---|---|
Gene ID | LotjaGi5g1v0122500 |
Transcript ID | LotjaGi5g1v0122500.1 |
Lotus japonicus genome version | Gifu v1.2 |
Description | Cytochrome c biogenesis; TAIR: ATMG00960.1 Cytochrome C assembly protein (ChrM); Swiss-Prot: sp|Q04647|CCBS_DAUCA Probable cytochrome c biosynthesis protein; TrEMBL-Plants: tr|R4IV25|R4IV25_VICFA Cytochrome b biogenesis FN; Found in the gene: LotjaGi5g1v0122500 |
Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr5:25855490..25856107) extracted from Lotus japonicus Gifu genome v1.2.
TTTAACACAACAAGACAATTAAACGATAGATTGTTCAACAACCAACAGTACAAAATCAAAGCTCTCTCAAACAGTAATGG TGTCATCATTCCTTTCTCCATCATCAGTGAACAGAAACGAGGTAGTTTTGAACAAATTTGGATCTTGACATGTCGGTGGT TTTTAACCGTGGGCATCATGCCAGGAAGTTGGTGGGCTCATCATGAATTAGGTCGGGGTGGCTGGTGGTTTCGGGATCCC ATAGAAAATGCTTCTTTTATGCCTTGGGTATTAGCCACAGCTCGTATTCATTCCGTAATTCTACCCCTTCTTCATTCTTG GATCTCGTTTCTGAATATTGTGACTCTTCCATGCTGTGTCTCAGGAACCTTTTCAATAACGTCCGGATTGCTAGCTTCCG TTCATAGTTTTGCTACAGATGATACACGAGGAATCTTTTTATGGCGGTTCTTCCTTCTAATGACCGGCATATCTATAATT CTTTTCTCCCAGATGAAGCAGCAGGCATCGGTCCGTAGAACTTATAAAAAAGAGATGGTTGTGGCGCGAAGTACTCTTGT GCACCTCCGTCACTCGGCTCGCGCGCAACCCCGCCCCGTTATGTTATGGAAGAATTGA
CDS sequence (LotjaGi5g1v0122500.1) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGCCAGGAAGTTGGTGGGCTCATCATGAATTAGGTCGGGGTGGCTGGTGGTTTCGGGATCCCATAGAAAATGCTTCTTT TATGCCTTGGGTATTAGCCACAGCTCGTATTCATTCCGTAATTCTACCCCTTCTTCATTCTTGGATCTCGTTTCTGAATA TTGTGACTCTTCCATGCTGTGTCTCAGGAACCTTTTCAATAACGTCCGGATTGCTAGCTTCCGTTCATAGTTTTGCTACA GATGATACACGAGGAATCTTTTTATGGCGGTTCTTCCTTCTAATGACCGGCATATCTATAATTCTTTTCTCCCAGATGAA GCAGCAGGCATCGGTCCGTAGAACTTATAAAAAAGAGATGGTTGTGGCGCGAAGTACTCTTGTGCACCTCCGTCACTCGG CTCGCGCGCAACCCCGCCCCGTTATGTTATGGAAGAATTGA
Protein sequence (LotjaGi5g1v0122500.1) extracted from Lotus japonicus Gifu v1.2 Proteins.
MPGSWWAHHELGRGGWWFRDPIENASFMPWVLATARIHSVILPLLHSWISFLNIVTLPCCVSGTFSITSGLLASVHSFAT DDTRGIFLWRFFLLMTGISIILFSQMKQQASVRRTYKKEMVVARSTLVHLRHSARAQPRPVMLWKN
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
---|---|---|---|---|---|---|
PANTHER | 1 | 131 | 131 | 5.0E-76 | – | |
Phobius | 1 | 26 | 26 | - | – | |
PANTHER | 1 | 131 | 131 | 5.0E-76 | – | |
Pfam | 3 | 70 | 68 | 3.1E-14 | ||
PRINTS | 22 | 42 | 21 | 1.7E-33 | ||
TMHMM | 27 | 49 | 23 | - | – | |
Phobius | 27 | 45 | 19 | - | – | |
PRINTS | 39 | 60 | 22 | 4.0E-21 | ||
Phobius | 46 | 51 | 6 | - | – | |
PRINTS | 48 | 68 | 21 | 1.7E-33 | ||
Phobius | 52 | 75 | 24 | - | – | |
TMHMM | 54 | 76 | 23 | - | – | |
PRINTS | 68 | 84 | 17 | 1.7E-33 | ||
Phobius | 76 | 86 | 11 | - | – | |
PRINTS | 84 | 103 | 20 | 1.7E-33 | ||
TMHMM | 86 | 104 | 19 | - | – | |
Phobius | 87 | 104 | 18 | - | – | |
PRINTS | 89 | 109 | 21 | 4.0E-21 | ||
Phobius | 105 | 146 | 42 | - | – |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
GO term | Namespace | Name | Definition | Relationships |
---|---|---|---|---|
Molecular function | Heme transporter activity | Enables the directed movement of heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring, into, out of or within a cell, or between cells. | ||
Biological process | Heme transport | The directed movement of heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. | ||
Cellular component | Membrane | A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it. | ||
Biological process | Cytochrome complex assembly | The aggregation, arrangement and bonding together of a cytochrome complex. A cytochrome complex is a protein complex in which at least one of the proteins is a cytochrome, i.e. a heme-containing protein involved in catalysis of redox reactions. | ||
Molecular function | Heme binding | Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring. |
Expression pattern of LotjaGi5g1v0122500.1, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…