Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
Field | Value |
---|---|
Gene ID | LotjaGi1g1v0003000 |
Transcript ID | LotjaGi1g1v0003000.2 |
Related isoforms 1 | |
Lotus japonicus genome version | Gifu v1.2 |
Description | AP-1 complex subunit sigma-1; TAIR: AT2G17380.1 associated protein 19; Swiss-Prot: sp|Q8LEZ8|AP1S1_ARATH AP-1 complex subunit sigma-1; TrEMBL-Plants: tr|I3T1A3|I3T1A3_LOTJA Uncharacterized protein; Found in the gene: LotjaGi1g1v0003000 |
Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr1:696342..697502) extracted from Lotus japonicus Gifu genome v1.2.
CTAGTACTTGTTTATGTATTTCTGATTTCCACATGCTTTGCTTTATTCCTCTTCCTTAATGTAGATTAACTTTGTGCTGC TCATTAGTCGTCAAGGGAAGGTCAGGCTCACAAAATGGTATTCACCTTACACTCAGAAGGAAAGAAATAAGGTAAATCCC TTATTCATTTTATCATCATTTTTAATCTTGTATGCATATTTCCATTCAGGGTATTCTTATGATTATTGCATGCTCAGCAC ATTGCATTATCAAACATATTTTCTTCTCTAGATAATCCGTGAGCTCAGTGGAATGGTTCTTAGCCGTGCACCTAAGCTCT GTAACTTTGTAGAGTGGAGAGGACAGAAAGTTGTTTATAAGAGGTATTCAGAGTACATCACTTTTAAATTTTAATCATAT GACACTGCTCCTCTGCCAGGCACTCTTCTGTTACCTTGATGTCTAATTCACTAAATTATAATGAATATCTGCTGCAGGTA TGCTAGCCTATATTTCTGCATGTGTATTGATGAAGAGGACAACGAGCTAGAAGTCCTTGAAATGATTCATCATTTTGTGG AGATTCTCGATCGGTACTTTGGCAGTGTGAGTCTATTGAAAGCTTTGAGTTTCGAAAATACTGCTTCATTTACTATAGGA AGGATATCAGGATTCTTGTGTCTGTAACTTGATAATGGTCACTTCTCATTTTACAGGTCTGTGAACTGGACTTGATATTC AACTTCCATAAGGTTTGTTCATATTTCATGATTCCAAAACAAGGGCTACTTATTTTCCTTTAACTTGTTACCATTTTATA TGATCCTTCCAAGGTGGTTCCGCCCTGAATGAGCAACAATTAATGATCATGTCAGCTGGCATTTATTTTGGTCAAGTAAT GCCCTTTCTGATATGTTCTCTGTTTTTGCATCATTGAAGGCCTACTATATACTAGATGAACTTCTAATTGCTGGTGAGCT TCAGGAATCGAGCAAAAAAACTATTGCCCGGTTGATTGCTGCACAGGTATGCAATGGTCTTTCTCTTTCAGATATGTTTT TACCTCAAAGGTTTTTATTAAACAACTTTCATGTGATAACGGCATTCAGGATTCATTGGTGGAGACTGCTAAGGAGGAGG CCAGTTCATTAAGTAATATAATCGCACAAGCAACTAAGTGA
CDS sequence (LotjaGi1g1v0003000.2) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGGTTCTTAGCCGTGCACCTAAGCTCTGTAACTTTGTAGAGTGGAGAGGACAGAAAGTTGTTTATAAGAGGTATGCTAG CCTATATTTCTGCATGTGTATTGATGAAGAGGACAACGAGCTAGAAGTCCTTGAAATGATTCATCATTTTGTGGAGATTC TCGATCGGTACTTTGGCAGTGTCTGTGAACTGGACTTGATATTCAACTTCCATAAGGCCTACTATATACTAGATGAACTT CTAATTGCTGGTGAGCTTCAGGAATCGAGCAAAAAAACTATTGCCCGGTTGATTGCTGCACAGGATTCATTGGTGGAGAC TGCTAAGGAGGAGGCCAGTTCATTAAGTAATATAATCGCACAAGCAACTAAGTGA
Protein sequence (LotjaGi1g1v0003000.2) extracted from Lotus japonicus Gifu v1.2 Proteins.
MVLSRAPKLCNFVEWRGQKVVYKRYASLYFCMCIDEEDNELEVLEMIHHFVEILDRYFGSVCELDLIFNFHKAYYILDEL LIAGELQESSKKTIARLIAAQDSLVETAKEEASSLSNIIAQATK
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
---|---|---|---|---|---|---|
CDD | 1 | 106 | 106 | 7.55868E-75 | – | |
Gene3D | 1 | 120 | 120 | 8.2E-47 | – | |
PIRSF | 1 | 115 | 115 | 4.8E-51 | ||
PANTHER | 2 | 124 | 123 | 5.6E-75 | – | |
SUPERFAMILY | 2 | 102 | 101 | 2.01E-34 | ||
PANTHER | 2 | 124 | 123 | 5.6E-75 | ||
Pfam | 2 | 103 | 102 | 2.0E-40 | ||
ProSitePatterns | 20 | 30 | 11 | - |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
GO term | Namespace | Name | Definition | Relationships |
---|---|---|---|---|
Biological process | Intracellular protein transport | The directed movement of proteins in a cell, including the movement of proteins between specific compartments or structures within a cell, such as organelles of a eukaryotic cell. | ||
Biological process | Protein transport | The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. | ||
Biological process | Vesicle-mediated transport | A cellular transport process in which transported substances are moved in membrane-bounded vesicles; transported substances are enclosed in the vesicle lumen or located in the vesicle membrane. The process begins with a step that directs a substance to the forming vesicle, and includes vesicle budding and coating. Vesicles are then targeted to, and fuse with, an acceptor membrane. | ||
Cellular component | Membrane coat | Any of several different proteinaceous coats that can associate with membranes. Membrane coats include those formed by clathrin plus an adaptor complex, the COPI and COPII complexes, and possibly others. They are found associated with membranes on many vesicles as well as other membrane features such as pits and perhaps tubules. |
Expression pattern of LotjaGi1g1v0003000.2, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…