Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
| Field | Value |
|---|---|
| Gene ID | LotjaGi2g1v0300300 |
| Transcript ID | LotjaGi2g1v0300300.4 |
| Related isoforms 3 | |
| Lotus japonicus genome version | Gifu v1.2 |
| Description | Vesicle transport v-SNARE family protein; TAIR: AT1G26670.1 Vesicle transport v-SNARE family protein; Swiss-Prot: sp|Q9SEL5|VTI12_ARATH Vesicle transport v-SNARE 12; TrEMBL-Plants: tr|A0A1J7IVB9|A0A1J7IVB9_LUPAN Uncharacterized protein; Found in the gene: LotjaGi2g1v0300300 |
| Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr2:77473842..77475414) extracted from Lotus japonicus Gifu genome v1.2.
TTTGATTGGTGTTATCTTTGAATTTGTTGCTTATTTCCCTCTTCTCTCTCTTCAGATTCGGAAGATGGACCTCGAGGCGA GAAGTTTGCAGCCGAGTGTAAAAGCAATGCTTCTTGCAAAGTTGAGGGAATACAAATCCGATCTAACCAAGTTGAAAAAA GAATTTAAAAGGTTAACATCTCCTAGTGCTGATCAGGCTGCCCGTGAAGATTTGCTGGAGGCTGGAATGGCAGATGCACA TTTGGTATACCTTTAACTCTTGTTTGTATTACTTAATAGCATATTTTTCTTTAAAAAAGGAAAGTAGGAAGCTAGTAACT TTCTTGGTTAGAGAGCTCCAACTTGGGGAAAAGTTCTGTTTCTAGTTGTGATTATGTTCCTTCTTATTTGTCTGTGAAAA ATGTTTTCTTCACTTCTATTACTCCTTCATGGGATCGTGAGTGATTATATCTTGACCTGTTAATCAGAGTAACTACCATT AAGAGAAGTGACCTTTTTCTTGATCGATATTTGATATTTCCTTAGTTTCTCACACTATTTCTAATTACTAATTTACTAGT GTCTATGTTATCCATTTATTGTAGAATAGTTGTGTTTTCCATTCCATCTGCTGTCTGTGAATTATGATTATAATGATTAT TAAACACGGCATATATATTATGTTTGATAGTGGCAGTGCTATGCCCATAAAGAGAATGAGACTGGTTGTTTCTTGTATAT AAGGTTGCAGATGTCTGCACATGTGTATATCGGGCTCTGTTTAGAATGTCTTCGTATTTTGTTTTTTGAATTTTGAAATT AATAGGTTTTTGAAATTGGATATACTTGTCATAATAGTATTTCTGTTGCAAATGCATATCTGGTTCTATGTTAGGCCTAT CCCCATGTTTTTGTTTTCTGAGTTTTGAAATTAGGAGGTTTTCTAGTTTTAAGCACTTGTAAGGCAAGTAGTGCACTTGA TCTGATGCTAATATATTGGGTAAATGTGGAAAATATTGCAGGCTTCTGCTGATCAGAGAGAAAGATTAACTATGTCGGTG GAGAGAATAAATGATTCGAGTGAGAGAATTAGGGAGAGCCGAAGAACCATTCTGGAGACTGAAGAACTCGGCGTCTCGAT CCTCCAAGATTTACACCAGCAGCGTGAGACTCTCCTGAGCTCCCATAAAAGGGTAGGTTGATATGTGAATGCTATGTTTT ATAATGGTTCTGCTTATCTCAACTTTAGTTTGGGTCATCATTTCATTTACTAGGACTAGGAAGGAATCATGGGATGATCT TATTCTCTAGGGCGAGAAGTATTAAAATCGAAAATGATACTTTTTCCTTGGAGAATAAGATTGCAAGCCTTAAGCATAAG GAGTGCAATGTTGAAATGGTGATAATTGTTGTGTGATGGTAATTTTTCTATCGCTTGCAGCTTCATGGGGTAGATGATGC TATTGACAAGAGTAAGAAGGTTTTAACCACCATGTCTCGCAGAATAACTAGACACAAATGGATCCTTGCATCTGTGATTG GAGCTCTTGTTTTAGCTATAGTTGTGATTCTATTTTACAAGCTATCCCATTAG
CDS sequence (LotjaGi2g1v0300300.4) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGGACCTCGAGGCGAGAAGTTTGCAGCCGAGTGTAAAAGCAATGCTTCTTGCAAAGTTGAGGGAATACAAATCCGATCT AACCAAGTTGAAAAAAGAATTTAAAAGGTTAACATCTCCTAGTGCTGATCAGGCTGCCCGTGAAGATTTGCTGGAGGCTG GAATGGCAGATGCACATTTGGCTTCTGCTGATCAGAGAGAAAGATTAACTATGTCGGTGGAGAGAATAAATGATTCGAGT GAGAGAATTAGGGAGAGCCGAAGAACCATTCTGGAGACTGAAGAACTCGGCGTCTCGATCCTCCAAGATTTACACCAGCA GCGTGAGACTCTCCTGAGCTCCCATAAAAGGCTTCATGGGGTAGATGATGCTATTGACAAGAGTAAGAAGGTTTTAACCA CCATGTCTCGCAGAATAACTAGACACAAATGGATCCTTGCATCTGTGATTGGAGCTCTTGTTTTAGCTATAGTTGTGATT CTATTTTACAAGCTATCCCATTAG
Protein sequence (LotjaGi2g1v0300300.4) extracted from Lotus japonicus Gifu v1.2 Proteins.
MDLEARSLQPSVKAMLLAKLREYKSDLTKLKKEFKRLTSPSADQAAREDLLEAGMADAHLASADQRERLTMSVERINDSS ERIRESRRTILETEELGVSILQDLHQQRETLLSSHKRLHGVDDAIDKSKKVLTTMSRRITRHKWILASVIGALVLAIVVI LFYKLSH
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
| Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
|---|---|---|---|---|---|---|
| Gene3D | 1 | 46 | 46 | 1.1E-9 | ||
| Pfam | 1 | 36 | 36 | 2.9E-10 | ||
| SUPERFAMILY | 1 | 39 | 39 | 1.26E-9 | ||
| Phobius | 1 | 143 | 143 | - | – | |
| PANTHER | 1 | 167 | 167 | 2.1E-88 | – | |
| PANTHER | 1 | 167 | 167 | 2.1E-88 | – | |
| PIRSF | 3 | 166 | 164 | 2.6E-12 | ||
| Coils | 13 | 33 | 21 | - | – | |
| Gene3D | 63 | 143 | 81 | 6.5E-24 | – | |
| SMART | 68 | 135 | 68 | 5.3E-4 | ||
| CDD | 73 | 134 | 62 | 7.70987E-20 | – | |
| Pfam | 74 | 138 | 65 | 1.6E-21 | – | |
| SUPERFAMILY | 76 | 135 | 60 | 8.29E-17 | – | |
| Phobius | 144 | 163 | 20 | - | – | |
| TMHMM | 144 | 163 | 20 | - | – | |
| Phobius | 164 | 167 | 4 | - | – |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
| GO term | Namespace | Name | Definition | Relationships |
|---|---|---|---|---|
| Molecular function | SNAP receptor activity | Acting as a marker to identify a membrane and interacting selectively with one or more SNAREs on another membrane to mediate membrane fusion. | ||
| Cellular component | Golgi apparatus | A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions. | ||
| Biological process | Intracellular protein transport | The directed movement of proteins in a cell, including the movement of proteins between specific compartments or structures within a cell, such as organelles of a eukaryotic cell. | ||
| Cellular component | Membrane | A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it. | ||
| Biological process | Vesicle-mediated transport | A cellular transport process in which transported substances are moved in membrane-bounded vesicles; transported substances are enclosed in the vesicle lumen or located in the vesicle membrane. The process begins with a step that directs a substance to the forming vesicle, and includes vesicle budding and coating. Vesicles are then targeted to, and fuse with, an acceptor membrane. |
Expression pattern of LotjaGi2g1v0300300.4, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…