Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
Field | Value |
---|---|
Gene ID | LotjaGi3g1v0495500 |
Transcript ID | LotjaGi3g1v0495500.3 |
Related isoforms 5 | |
Lotus japonicus genome version | Gifu v1.2 |
Description | Histone H3; TAIR: AT1G09200.1 Histone superfamily protein; Swiss-Prot: sp|P68429|H32_MEDSA Histone H3.2; TrEMBL-Plants: tr|G7L647|G7L647_MEDTR Core histone H2A/H2B/H3/H4; Found in the gene: LotjaGi3g1v0495500 |
Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr3:91371515..91372084) extracted from Lotus japonicus Gifu genome v1.2.
ATTTTCACAAATCTCCACCCTATAAATAATCTCCATCTGTAACTTCCTCTTCACCACACAAACACATTTCAATTTCAATT TCAATTTCAATTTCAATTTCAATTTCAATTTCAATTTCAATCCCTTTGCAATTTTCACCAGTTACGTTTCCAGATCCAGA TGGCTCGTACAAAGCAAACCGCCAGAAAATCCACCGGAGGCAAGGCGCCGAGGAAGCAGCTAGCAACCAAGGCCGCCCGC AAATCTGCCCCTGCCACCGGCGGCGTGAAGAAGCCCCACCGTTTCAGACCTGGAACCGTCGCTCTGAGGGAGATCCGTAA GTACCAGAAGAGCACTGAGCTTCTCATCAGGAAGCTTCCATTCCAGAGGCTGGTCAGAGAGATCGCTCAGGATTTCAAGA CCGATCTCCGATTCCAGAGCAGCGCCGTCTCCGCTCTGCAAGAGGCTGCCGAGGCGTACCTGGTTGGGCTTTTTGAGGAT ACCAACCTCTGTGCGATTCATGCTAAGAGGGTGACCATCATGCCGAAGGATATTCAGCTTGCTCGTAGGATTAGGGGTGA AAGGGCTTAG
CDS sequence (LotjaGi3g1v0495500.3) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGGCTCGTACAAAGCAAACCGCCAGAAAATCCACCGGAGGCAAGGCGCCGAGGAAGCAGCTAGCAACCAAGGCCGCCCG CAAATCTGCCCCTGCCACCGGCGGCGTGAAGAAGCCCCACCGTTTCAGACCTGGAACCGTCGCTCTGAGGGAGATCCGTA AGTACCAGAAGAGCACTGAGCTTCTCATCAGGAAGCTTCCATTCCAGAGGCTGGTCAGAGAGATCGCTCAGGATTTCAAG ACCGATCTCCGATTCCAGAGCAGCGCCGTCTCCGCTCTGCAAGAGGCTGCCGAGGCGTACCTGGTTGGGCTTTTTGAGGA TACCAACCTCTGTGCGATTCATGCTAAGAGGGTGACCATCATGCCGAAGGATATTCAGCTTGCTCGTAGGATTAGGGGTG AAAGGGCTTAG
Protein sequence (LotjaGi3g1v0495500.3) extracted from Lotus japonicus Gifu v1.2 Proteins.
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFK TDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
---|---|---|---|---|---|---|
PANTHER | 1 | 136 | 136 | 4.4E-108 | – | |
MobiDBLite | 1 | 43 | 43 | - | – | |
PANTHER | 1 | 136 | 136 | 4.4E-108 | ||
Pfam | 1 | 132 | 132 | 7.9E-54 | ||
Gene3D | 2 | 136 | 135 | 2.3E-79 | ||
SUPERFAMILY | 2 | 133 | 132 | 7.04E-57 | ||
PRINTS | 3 | 17 | 15 | 1.5E-85 | ||
ProSitePatterns | 15 | 21 | 7 | - | ||
PRINTS | 17 | 31 | 15 | 1.5E-85 | ||
SMART | 34 | 136 | 103 | 2.3E-74 | ||
PRINTS | 34 | 55 | 22 | 1.5E-85 | ||
PRINTS | 58 | 75 | 18 | 1.5E-85 | ||
ProSitePatterns | 67 | 75 | 9 | - | ||
PRINTS | 80 | 98 | 19 | 1.5E-85 | ||
PRINTS | 98 | 114 | 17 | 1.5E-85 | ||
PRINTS | 114 | 135 | 22 | 1.5E-85 |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
GO term | Namespace | Name | Definition | Relationships |
---|---|---|---|---|
Cellular component | Nucleosome | A complex comprised of DNA wound around a multisubunit core and associated proteins, which forms the primary packing unit of DNA into higher order structures. | ||
Molecular function | DNA binding | Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid). | ||
Molecular function | Protein heterodimerization activity | Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer. |
Expression pattern of LotjaGi3g1v0495500.3, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…