Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
| Field | Value |
|---|---|
| Gene ID | LotjaGi6g1v0129600 |
| Transcript ID | LotjaGi6g1v0129600.1 |
| Related isoforms 1 | |
| Lotus japonicus genome version | Gifu v1.2 |
| Description | Histone H4; TAIR: AT1G07660.1 Histone superfamily protein; Swiss-Prot: sp|P84048|H4_ACRAS Histone H4; TrEMBL-Plants: tr|K7VQC2|K7VQC2_MAIZE Histone H4; Found in the gene: LotjaGi6g1v0129600 |
| Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr6:34042389..34042700) extracted from Lotus japonicus Gifu genome v1.2.
ATGACCGGCCGAGGCAAGGGAGGAAAGGGATTGGGAAAGGGTGGCGCCAAACGTCATCGTAAGGTGCTGCGTGACAACAT CCAGGGAATCACCAAGCCCGCCATCCGTCGTCTGGCTCGCCGTGGTGGAGTCAAGCGTATCTCCGGTCTCATCTACGAGG AGACCCGTGGTGTGCTCAAGGTGTTCCTTGAAAACGTCATCCGTGACGCCGTCACCTACACCGAGCACGCCAAGAGGAAG ACCGTGACTGCCATGGACGTAGTCTACGCCCTCAAGCGTCAGGGACGTACCCTGTACGGTTTCGGAGGTTAA
CDS sequence (LotjaGi6g1v0129600.1) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGACCGGCCGAGGCAAGGGAGGAAAGGGATTGGGAAAGGGTGGCGCCAAACGTCATCGTAAGGTGCTGCGTGACAACAT CCAGGGAATCACCAAGCCCGCCATCCGTCGTCTGGCTCGCCGTGGTGGAGTCAAGCGTATCTCCGGTCTCATCTACGAGG AGACCCGTGGTGTGCTCAAGGTGTTCCTTGAAAACGTCATCCGTGACGCCGTCACCTACACCGAGCACGCCAAGAGGAAG ACCGTGACTGCCATGGACGTAGTCTACGCCCTCAAGCGTCAGGGACGTACCCTGTACGGTTTCGGAGGTTAA
Protein sequence (LotjaGi6g1v0129600.1) extracted from Lotus japonicus Gifu v1.2 Proteins.
MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK TVTAMDVVYALKRQGRTLYGFGG
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
| Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
|---|---|---|---|---|---|---|
| PANTHER | 1 | 103 | 103 | 8.7E-73 | – | |
| MobiDBLite | 1 | 20 | 20 | - | – | |
| PANTHER | 1 | 103 | 103 | 8.7E-73 | – | |
| Gene3D | 2 | 103 | 102 | 2.2E-60 | ||
| SUPERFAMILY | 3 | 102 | 100 | 8.38E-33 | ||
| PRINTS | 5 | 16 | 12 | 1.4E-63 | ||
| ProSitePatterns | 15 | 19 | 5 | - | ||
| SMART | 16 | 90 | 75 | 2.9E-29 | ||
| CDD | 18 | 101 | 84 | 1.39064E-43 | ||
| PRINTS | 20 | 39 | 20 | 1.4E-63 | ||
| SMART | 28 | 93 | 66 | 0.0086 | ||
| Pfam | 35 | 96 | 62 | 2.2E-8 | ||
| PRINTS | 40 | 60 | 21 | 1.4E-63 | ||
| PRINTS | 62 | 76 | 15 | 1.4E-63 | ||
| PRINTS | 77 | 89 | 13 | 1.4E-63 | ||
| PRINTS | 89 | 100 | 12 | 1.4E-63 |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
| GO term | Namespace | Name | Definition | Relationships |
|---|---|---|---|---|
| Cellular component | Nucleosome | A complex comprised of DNA wound around a multisubunit core and associated proteins, which forms the primary packing unit of DNA into higher order structures. | ||
| Molecular function | DNA binding | Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid). | ||
| Biological process | DNA-templated transcription, initiation | Any process involved in the assembly of the RNA polymerase preinitiation complex (PIC) at the core promoter region of a DNA template, resulting in the subsequent synthesis of RNA from that promoter. The initiation phase includes PIC assembly and the formation of the first few bonds in the RNA chain, including abortive initiation, which occurs when the first few nucleotides are repeatedly synthesized and then released. The initiation phase ends just before and does not include promoter clearance, or release, which is the transition between the initiation and elongation phases of transcription. | ||
| Cellular component | Host cell nucleus | A membrane-bounded organelle as it is found in the host cell in which chromosomes are housed and replicated. The host is defined as the larger of the organisms involved in a symbiotic interaction. | ||
| Molecular function | Protein heterodimerization activity | Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer. |
Expression pattern of LotjaGi6g1v0129600.1, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…