Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi2g1v0286700.2

Overview

Field Value
Gene ID LotjaGi2g1v0286700
Transcript ID LotjaGi2g1v0286700.2
Related isoforms 1
Lotus japonicus genome version Gifu v1.2
Description 60S acidic ribosomal protein; TAIR: AT3G44590.1 60S acidic ribosomal protein family; Swiss-Prot: sp|Q9LXM8|RLA24_ARATH 60S acidic ribosomal protein P2-4; TrEMBL-Plants: tr|I3SKJ7|I3SKJ7_LOTJA Uncharacterized protein; Found in the gene: LotjaGi2g1v0286700
Working Lj name n.a.

Sequence information

Genomic sequence (LjG1.1_chr2:75971832..75972487) extracted from Lotus japonicus Gifu genome v1.2.

ATGAAGGTAGTCGCCGCTTACTTGCTCGCTGTTTTGGGTGGCAATTCTTCCCCCTCCGCCGATGATCTCAAAAACATCCT TGGCTCAGGTTCTTATTCTCATTCTCTTTTTCATTCTCTGTTTTCTTGGTGAATGATGCTTCTATATCATGTAGTTAGAA ATTGAAATTATTTGATTTTTACCAATAATAGTTTGAATTCTTACTCCATGATTTATATGTTGAATTTTGATGGAACCCTA ATGAAATGGGGTTTTGAATTAGCTGTAGTGAGTTGAATATTTTGGTTTATGATTTATGTAGTTGGAATTGAGATTGAAGA TGAGTTGATTGAGTTGCTCTTGAAAGAAGTCAAGGGCAAGGACTTCGCCGAGCTGATTGCCAGTGGTAGAGAAAAGTTGT CTGCTGTGCCTTCCGGTGGTATTGCTGTTTCTGTTGCTGCTGTATCTGGAGGAGGTGCTGCAGCTGGTGGCGCGGCTCCT GCTGCTGAAGCAAAGGAGGAAAAGAAGGAAGTAGAGAAGGAAGAGTCTGATGATGTAAGTTTTGCAATTGTAGCTCTGTT GATTGATATTTAGTGAATTAATGACTATATGCTTATGATTGATATATTATGTTTGTATCTGTTTTGCAGGATATGGGTTT CAGTTTATTCGACTAA 

CDS sequence (LotjaGi2g1v0286700.2) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGAAGGTAGTCGCCGCTTACTTGCTCGCTGTTTTGGGTGGCAATTCTTCCCCCTCCGCCGATGATCTCAAAAACATCCT TGGCTCAGTTGGAATTGAGATTGAAGATGAGTTGATTGAGTTGCTCTTGAAAGAAGTCAAGGGCAAGGACTTCGCCGAGC TGATTGCCAGTGGTAGAGAAAAGTTGTCTGCTGTGCCTTCCGGTGGTATTGCTGTTTCTGTTGCTGCTGTATCTGGAGGA GGTGCTGCAGCTGGTGGCGCGGCTCCTGCTGCTGAAGCAAAGGAGGAAAAGAAGGAAGTAGAGAAGGAAGAGTCTGATGA TGATATGGGTTTCAGTTTATTCGACTAA 

Protein sequence (LotjaGi2g1v0286700.2) extracted from Lotus japonicus Gifu v1.2 Proteins.

MKVVAAYLLAVLGGNSSPSADDLKNILGSVGIEIEDELIELLLKEVKGKDFAELIASGREKLSAVPSGGIAVSVAAVSGG GAAAGGAAPAAEAKEEKKEVEKEESDDDMGFSLFD 

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Merging data from EBeye. Please wait…

Domains

Sorting

Prediction algorithm Identifier Start End Length E-value InterPro ID
Gene3D 1 59 59 5.5E-26
CDD 1 115 115 2.38451E-32
PANTHER 1 115 115 1.5E-53
PANTHER 1 115 115 1.5E-53
Phobius 1 19 19 -
Phobius 1 2 2 -
Hamap 2 115 114 16.55
Phobius 3 14 12 -
Phobius 15 19 5 -
Pfam 17 114 98 2.4E-23
Phobius 20 115 96 -
MobiDBLite 80 115 36 -
MobiDBLite 91 109 19 -

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .

GO term Namespace Name Definition Relationships
Molecular function Structural constituent of ribosome The action of a molecule that contributes to the structural integrity of the ribosome.
Cellular component Ribosome An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.
Biological process Translational elongation The successive addition of amino acid residues to a nascent polypeptide chain during protein biosynthesis.

Expression data

Expression pattern

Expression pattern of LotjaGi2g1v0286700.2, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…