Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi5g1v0029600.1

Overview

Field Value
Gene ID LotjaGi5g1v0029600
Transcript ID LotjaGi5g1v0029600.1
Lotus japonicus genome version Gifu v1.2
Description Small nuclear ribonucleoprotein; TAIR: AT4G30220.1 small nuclear ribonucleoprotein F; Swiss-Prot: sp|Q9SUM2|RUXF_ARATH Probable small nuclear ribonucleoprotein F; TrEMBL-Plants: tr|I3SY08|I3SY08_LOTJA Uncharacterized protein; Found in the gene: LotjaGi5g1v0029600
Working Lj name n.a.

Sequence information

Genomic sequence (LjG1.1_chr5:4867989..4868979) extracted from Lotus japonicus Gifu genome v1.2.

ATGGCGGTGAGCTCTTGCATCCCTCCCTCATCGAATCATGTTCTTTACATTCATTGAATTTACTTATAAGGCTGTGTTTG GTTCCTCTTGTTTTGCAGACTATACCTGTTAATCCAAAGCCATTCTTGAACAATTTGACTGGGAAGCCAGTTATTGTCAA ACTCAAGTGGGGAATGGAGTACAAGGGATATCTTGTTTCAGTTGACTCCTACATGAACTTGCAGCTGGCCAACACTGAAG AGTACATTGAGGGTCAGTTTACTGGAAATTTAGGAGAGATTTTAATCAGGTAACTTGCATCATTCTCAACTATTCCATTT GCTATGTTTTGAATTTGATGTTAAAGAATTGGAAGCTAGGTTTTGTTTCCCTAGGCATTTGATATTTTTAAATATAAAAA ACTATGTGCTTTGTTACATGTTTTGAGAGCTACAAGATGACATGATATATGATTCTGTAATCATGTTAGTTTAATTCAAC AAAGTGATCTTGGCGTAGGTGATTTATATTGCCCGAACTGCTTTTTAGTGTTTGTTTTTGTTTCTCTTGTTTCAATTACA TGGTTTGAAGCTATTGGATTGTGTCATCACACTAGTCAATTCTGAAAAAAAGGGGGTTTCTACAATTTATGTTATGGCTT TGTTTCGATATCAGGATTTGTAACTAAAATATTATTTGGGTCATATTCCAGATAAAAAATTTTAAAGGCAGTAACACTGG TGGTGTTCTTTCATATTTCTCAACATTGCTGAATGTCTGACCAGGAATACTGTTACACTTTTGAAACTTGAAAGCAATAT ATGCATCTCTTCTTTTGTGCCTGTTGTGCTTTTATTCTCTTAATTAGATGTAAGATTGTTTCCTTTCAGAATGTCATTTT TTGAATACCATTGTTAAATTTTATTTCACTTATATTTATAGATGCAACAACGTCCTCTACCTTCGTGGAGTACCAGAGGA TGAAGAAATTGAAGATGCTCCAGAAGACTAG 

CDS sequence (LotjaGi5g1v0029600.1) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGGCGACTATACCTGTTAATCCAAAGCCATTCTTGAACAATTTGACTGGGAAGCCAGTTATTGTCAAACTCAAGTGGGG AATGGAGTACAAGGGATATCTTGTTTCAGTTGACTCCTACATGAACTTGCAGCTGGCCAACACTGAAGAGTACATTGAGG GTCAGTTTACTGGAAATTTAGGAGAGATTTTAATCAGATGCAACAACGTCCTCTACCTTCGTGGAGTACCAGAGGATGAA GAAATTGAAGATGCTCCAGAAGACTAG 

Protein sequence (LotjaGi5g1v0029600.1) extracted from Lotus japonicus Gifu v1.2 Proteins.

MATIPVNPKPFLNNLTGKPVIVKLKWGMEYKGYLVSVDSYMNLQLANTEEYIEGQFTGNLGEILIRCNNVLYLRGVPEDE EIEDAPED 

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Merging data from EBeye. Please wait…

Domains

Sorting

Prediction algorithm Identifier Start End Length E-value InterPro ID
PANTHER 1 83 83 2.7E-47
PIRSF 1 84 84 1.3E-38
PANTHER 1 83 83 2.7E-47
Gene3D 2 86 85 2.0E-32
CDD 7 75 69 6.41306E-50
SUPERFAMILY 8 77 70 4.3E-23
SMART 10 75 66 3.8E-25
Pfam 11 73 63 1.0E-21

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .

GO term Namespace Name Definition Relationships
Biological process Spliceosomal snRNP assembly The aggregation, arrangement and bonding together of one or more snRNA and multiple protein components to form a ribonucleoprotein complex that is involved in formation of the spliceosome.
Biological process MRNA splicing, via spliceosome The joining together of exons from one or more primary transcripts of messenger RNA (mRNA) and the excision of intron sequences, via a spliceosomal mechanism, so that mRNA consisting only of the joined exons is produced.
Cellular component Spliceosomal complex Any of a series of ribonucleoprotein complexes that contain snRNA(s) and small nuclear ribonucleoproteins (snRNPs), and are formed sequentially during the spliceosomal splicing of one or more substrate RNAs, and which also contain the RNA substrate(s) from the initial target RNAs of splicing, the splicing intermediate RNA(s), to the final RNA products. During cis-splicing, the initial target RNA is a single, contiguous RNA transcript, whether mRNA, snoRNA, etc., and the released products are a spliced RNA and an excised intron, generally as a lariat structure. During trans-splicing, there are two initial substrate RNAs, the spliced leader RNA and a pre-mRNA.
Cellular component Small nucleolar ribonucleoprotein complex A ribonucleoprotein complex that contains an RNA molecule of the small nucleolar RNA (snoRNA) family and associated proteins. Most are involved in a step of processing of rRNA: cleavage, 2'-O-methylation, or pseudouridylation. The majority, though not all, fall into one of two classes, box C/D type or box H/ACA type.

Expression data

Expression pattern

Expression pattern of LotjaGi5g1v0029600.1, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…