Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

Lj4g3v0281040.1

Overview

Field Value
Gene ID Lj4g3v0281040
Transcript ID Lj4g3v0281040.1
Lotus japonicus genome version MG20 v3.0
Description flagellin-sensing 2-like protein [Lotus japonicus] gi|355346200|gb|AER60531.1|
Working Lj name LjFls2

Sequence information

Genomic sequence (chr4:3284600..3289068) extracted from Lotus japonicus MG20 genome v3.0.

GTTACAATGGGGTCATGAGCATTATCTATAAAGGCTTCATTTACCAAAGCTAATGTCAGCAAGCTGCAATTGAATTTTCT CTTAAATTCAACAGTGATGTTATCTCTAAAGTTTAGTTTGACTCTGGTCATAGTCTTTTCAATTGTAGCCTCAGTTTCAT GTGCTGAGAATGTTGAAACTGAAGCTTTGAAAGCTTTCAAGAAGTCCATCACAAATGACCCAAATGGAGTCCTTGCAGAT TGGGTTGACACCCACCATCACTGCAACTGGTCTGGGATTGCATGTGACTCTACAAATCATGTTGTTTCAATTACTCTGGC TAGTTTTCAGCTCCAAGGTGAGATTTCACCATTCCTTGGAAACATTTCTGGCCTTCAGCTTCTTGACTTAACTTCAAATT TGTTTACTGGGTTTATTCCCTCTGAGCTCAGTCTCTGCACTCAACTTTCTGAACTGGATCTTGTTGAAAATTCTCTCTCA GGACCAATCCCTCCTGCATTAGGAAACCTGAAAAATCTGCAGTATTTGGATTTAGGTAGTAACCTTTTGAATGGAACCCT CCCTGAGAGTTTATTCAACTGCACTTCTTTGTTGGGTATTGCTTTCAATTTCAACAACCTCACTGGGAAAATCCCATCAA ACATTGGGAATCTTATCAACATTATACAAATTGTAGGGTTTGGGAATGCTTTTGTTGGGTCTATACCTCATTCCATAGGT CATTTGGGAGCTTTGAAATCTCTTGATTTTAGCCAAAACCAGTTATCAGGTGTGATACCTCCAGAGATTGGAAAGCTGAC AAATTTAGAAAACCTACTACTGTTTCAAAATTCCTTGACTGGGAAAATCCCTTCTGAGATTTCTCAGTGTACCAATCTTA TATACCTTGAGTTATATGAAAATAAGTTCATTGGAAGCATTCCTCCTGAGCTAGGAAGTCTAGTCCAATTGCTGACTTTG AGGTTATTTAGCAATAACTTAAACTCCACCATTCCATCTTCCATATTTCGGTTGAAATCGCTAACGCACTTAGGACTCTC AGACAATAACTTAGAGGGAACAATCTCTTCTGAGATTGGATCTCTGAGTTCCTTACAAGTGCTAACCCTGCATTTGAACA AGTTTACTGGGAAAATCCCTTCATCAATAACAAACTTGAGAAACTTGACATCTCTGGCTATTAGTCAGAATTTCCTTTCA GGTGAACTCCCTCCAGACCTGGGAAAGCTTCACAATTTGAAGATTCTTGTCTTGAATAACAACATTCTACATGGACCCAT TCCCCCTAGCATTACCAATTGTACTGGCTTGGTGAATGTGAGTTTGTCTTTTAATGCTTTCACTGGGGGAATTCCTGAGG GCATGTCAAGGCTGCATAACCTCACTTTTCTGTCTCTTGCGTCAAACAAAATGAGTGGGGAAATCCCTGATGACCTCTTC AACTGCTCAAATCTTAGTACTCTAAGTCTAGCAGAAAACAACTTCAGCGGATTGATTAAACCTGATATCCAGAACCTGTT GAAACTCTCGCGTTTGCAACTACATACAAATTCTTTCACGGGACTGATCCCGCCGGAGATTGGAAACTTGAATCAACTCA TCACTTTGACCCTTTCTGAAAATAGATTTTCAGGTCGAATTCCACCAGAACTTTCCAAACTTTCTCCCCTTCAGGGACTC TCCCTCCATGAGAATTTATTAGAAGGCACAATACCTGATAAACTCTCTGATTTAAAAAGACTAACAACACTTTCATTGAA TAACAACAAGTTGGTTGGTCAAATACCAGATTCTATCTCAAGCCTTGAGATGCTTTCATTCTTAGACCTCCATGGAAACA AATTGAATGGATCCATTCCCAGAAGCATGGGGAAGCTTAATCATCTTTTAATGTTGGATCTCTCTCACAACGACCTCACG GGATCGATTCCGGGAGATGTCATTGCACACTTCAAAGACATGCAGATGTATCTTAACCTTTCAAACAACCACTTGGTGGG AAGTGTTCCACCAGAGCTGGGAATGTTGGTAATGACACAGGCCATTGATGTTTCAAACAACAATCTTTCGAGTTTCCTTC CTGAGACGCTTTCCGGGTGCAGAAATCTGTTCAGTCTTGATTTTTCAGGAAACAATATTTCAGGTCCTATTCCTGGAAAA GCTTTTAGTCAGATGGATTTGCTTCAAAGCTTAAACCTTTCAAGAAATCATTTAGAAGGTGAAATCCCTGACACCTTGGT AAAGCTTGAGCATCTTAGTTCCCTGGATCTTTCTCAGAACAAATTGAAGGGAACCATTCCTCAGGGCTTTGCCAATCTTT CTAACCTGCTGCATCTCAATCTTTCTTTCAATCAACTTGAAGGTCCTATACCTACAACAGGAATCTTTGCACATATCAAT GCATCTAGTATGATGGGAAACCAGGCTCTTTGTGGAGCGAAACTCCAACGGCCATGCCGAGAGAGTGGTCATACACTATC CAAGAAGGGCATAGCCATTATCGCTGCACTTGGATCTCTTGCTATAATTCTACTTCTATTGTTTGTGATTTTAATTCTGA ATCGACGCACCAGACTCAGAAATTCTAAACCAAGAGATGACAGTGTGAAATATGAACCAGGGTTTGGTTCAGCATTGGCT CTTAAAAGATTCAAGCCAGAGGAGTTTGAAAATGCCACTGGTTTTTTCAGTCCTGCCAATATCATTGGTGCTAGCAGCTT GAGCACAGTTTACAAGGGTCAATTTGAGGATGGCCACACTGTAGCCATAAAAAGATTGAATCTGCACCATTTCGCTGCAG ATACTGACAAGATCTTCAAGAGAGAAGCCAGCACCTTGAGCCAGTTGAGACACAGGAATTTGGTTAAAGTAGTTGGGTAT GCATGGGAGAGTGGGAAAATGAAGGCTTTAGCTCTAGAGTACATGGAAAATGGCAACTTGGATAGCATCATACATGACAA AGAAGTAGATCAGTCAAGGTGGACATTATCTGAAAGACTTCGAGTTTTCATTTCTATTGCTAATGGGTTGGAATATTTGC ACTCCGGTTATGGTACTCCCATTGTGCACTGTGATCTAAAGCCTTCTAATGTCCTTTTAGACACAGACTGGGAAGCTCAT GTCAGTGATTTTGGTACAGCTCGAATACTTGGTCTTCATCTACAGGAAGGTAGTACCCTTTCCTCAACAGCCGCTTTGCA AGGCACAGTTGGTTATTTGGCACCAGGTATAAGCCTTAATATATAACTAATCTCTTATACTCAATGCATAATATATTTTC ATCACAGTTATGTTCATGTTAGAATCTAAATGAATAATTTAACTCTTGTTGGATTTGTATAGTGACTTAGTGAGTAAATC CTGCACATTGGATTGTTCTAATCAGCAAAAGTAGCACTTATAGTTCAAGATTTGAATATGTATTAGTGTTATATTTTCTG TTTTATACAATGCATGTGAGTCCATATAGGTTCTGTTTGAATATGTTCTGTTTCCCTTTTCACCCAATGTGTGTTCACTA TGTGCTGACTTCTAGTTATTGACATGTAATTCAGGAAAAGGCTGAGACATTTGTTAATAGATTCACAGAAGCACCGAGAA CACTGTTTCATTAGATAGCAAAGATAATATAACTTCCCTTCTCTAATATTGAACTGAGTTTGTTCTCAAAGAGATAGCTA TTGCTTGCTATTATAACCAAAGATTTTTAAGAAAATCTCAAATATAATGTTGTTGTTTGTTTCCAATTCTAATAGCTTAT AACTTTGTATACCTAAAGGTTCATATGACTGTCACTCTCTAAACAAGATTTTTCTTTGAAATTCCCAGAATTTGCTTACA TAAGGAAAGTAACTACTAAAGCGGATGTGTTCAGCTTTGGAATCATAGTAATGGAGTTTCTAACAAGAAGAAGGCCTACA GGGCTCTCAGAAGAGGATGACGGCTTGCCAATCACTTTGCGTGAAGTAGTCGCAAGAGCCCTTGCAAATGGAACTGAACA GCTTGTTAATATTGTGGACCCTATGCTGACCTGCAATGTCACAGAATACCATGTTGAAGTCTTGACAGAGCTCATTAAGC TTTCATTGCTCTGCACCCTCCCTGATCCTGAAAGTCGACCTAATATGAATGAGGTTCTATCTGCACTTATGAAGCTTCAA ACAGAAAAATAGTACTACTGTCTTGTTAAATGGCAAACACCTTCAGTCAATCCTTGGTGCTGCTTTTTCAGAAGATGAAA CATTGAGTGTTTTCCAATTACTTCATTTTTAGTGTGTTTAACAATGGCAAAGCTATCTGGTATCAATGTAAGTTTTACAA TTATGATGAAAGGCATCCGATATTTTTTGTACTCGAGTCTGCAATTAGTAAGTGGAACTTTCGTACAATGACTAGTATTC TTTCACAACCTTATAGCATTGATAGACTTGCTGCAAACTCTTTTCTTTTCACTCTCCCTCCCCACTGTT 

CDS sequence (Lj4g3v0281040.1) extracted from Lotus japonicus MG20 v3.0 CDS.

ATGTTATCTCTAAAGTTTAGTTTGACTCTGGTCATAGTCTTTTCAATTGTAGCCTCAGTTTCATGTGCTGAGAATGTTGA AACTGAAGCTTTGAAAGCTTTCAAGAAGTCCATCACAAATGACCCAAATGGAGTCCTTGCAGATTGGGTTGACACCCACC ATCACTGCAACTGGTCTGGGATTGCATGTGACTCTACAAATCATGTTGTTTCAATTACTCTGGCTAGTTTTCAGCTCCAA GGTGAGATTTCACCATTCCTTGGAAACATTTCTGGCCTTCAGCTTCTTGACTTAACTTCAAATTTGTTTACTGGGTTTAT TCCCTCTGAGCTCAGTCTCTGCACTCAACTTTCTGAACTGGATCTTGTTGAAAATTCTCTCTCAGGACCAATCCCTCCTG CATTAGGAAACCTGAAAAATCTGCAGTATTTGGATTTAGGTAGTAACCTTTTGAATGGAACCCTCCCTGAGAGTTTATTC AACTGCACTTCTTTGTTGGGTATTGCTTTCAATTTCAACAACCTCACTGGGAAAATCCCATCAAACATTGGGAATCTTAT CAACATTATACAAATTGTAGGGTTTGGGAATGCTTTTGTTGGGTCTATACCTCATTCCATAGGTCATTTGGGAGCTTTGA AATCTCTTGATTTTAGCCAAAACCAGTTATCAGGTGTGATACCTCCAGAGATTGGAAAGCTGACAAATTTAGAAAACCTA CTACTGTTTCAAAATTCCTTGACTGGGAAAATCCCTTCTGAGATTTCTCAGTGTACCAATCTTATATACCTTGAGTTATA TGAAAATAAGTTCATTGGAAGCATTCCTCCTGAGCTAGGAAGTCTAGTCCAATTGCTGACTTTGAGGTTATTTAGCAATA ACTTAAACTCCACCATTCCATCTTCCATATTTCGGTTGAAATCGCTAACGCACTTAGGACTCTCAGACAATAACTTAGAG GGAACAATCTCTTCTGAGATTGGATCTCTGAGTTCCTTACAAGTGCTAACCCTGCATTTGAACAAGTTTACTGGGAAAAT CCCTTCATCAATAACAAACTTGAGAAACTTGACATCTCTGGCTATTAGTCAGAATTTCCTTTCAGGTGAACTCCCTCCAG ACCTGGGAAAGCTTCACAATTTGAAGATTCTTGTCTTGAATAACAACATTCTACATGGACCCATTCCCCCTAGCATTACC AATTGTACTGGCTTGGTGAATGTGAGTTTGTCTTTTAATGCTTTCACTGGGGGAATTCCTGAGGGCATGTCAAGGCTGCA TAACCTCACTTTTCTGTCTCTTGCGTCAAACAAAATGAGTGGGGAAATCCCTGATGACCTCTTCAACTGCTCAAATCTTA GTACTCTAAGTCTAGCAGAAAACAACTTCAGCGGATTGATTAAACCTGATATCCAGAACCTGTTGAAACTCTCGCGTTTG CAACTACATACAAATTCTTTCACGGGACTGATCCCGCCGGAGATTGGAAACTTGAATCAACTCATCACTTTGACCCTTTC TGAAAATAGATTTTCAGGTCGAATTCCACCAGAACTTTCCAAACTTTCTCCCCTTCAGGGACTCTCCCTCCATGAGAATT TATTAGAAGGCACAATACCTGATAAACTCTCTGATTTAAAAAGACTAACAACACTTTCATTGAATAACAACAAGTTGGTT GGTCAAATACCAGATTCTATCTCAAGCCTTGAGATGCTTTCATTCTTAGACCTCCATGGAAACAAATTGAATGGATCCAT TCCCAGAAGCATGGGGAAGCTTAATCATCTTTTAATGTTGGATCTCTCTCACAACGACCTCACGGGATCGATTCCGGGAG ATGTCATTGCACACTTCAAAGACATGCAGATGTATCTTAACCTTTCAAACAACCACTTGGTGGGAAGTGTTCCACCAGAG CTGGGAATGTTGGTAATGACACAGGCCATTGATGTTTCAAACAACAATCTTTCGAGTTTCCTTCCTGAGACGCTTTCCGG GTGCAGAAATCTGTTCAGTCTTGATTTTTCAGGAAACAATATTTCAGGTCCTATTCCTGGAAAAGCTTTTAGTCAGATGG ATTTGCTTCAAAGCTTAAACCTTTCAAGAAATCATTTAGAAGGTGAAATCCCTGACACCTTGGTAAAGCTTGAGCATCTT AGTTCCCTGGATCTTTCTCAGAACAAATTGAAGGGAACCATTCCTCAGGGCTTTGCCAATCTTTCTAACCTGCTGCATCT CAATCTTTCTTTCAATCAACTTGAAGGTCCTATACCTACAACAGGAATCTTTGCACATATCAATGCATCTAGTATGATGG GAAACCAGGCTCTTTGTGGAGCGAAACTCCAACGGCCATGCCGAGAGAGTGGTCATACACTATCCAAGAAGGGCATAGCC ATTATCGCTGCACTTGGATCTCTTGCTATAATTCTACTTCTATTGTTTGTGATTTTAATTCTGAATCGACGCACCAGACT CAGAAATTCTAAACCAAGAGATGACAGTGTGAAATATGAACCAGGGTTTGGTTCAGCATTGGCTCTTAAAAGATTCAAGC CAGAGGAGTTTGAAAATGCCACTGGTTTTTTCAGTCCTGCCAATATCATTGGTGCTAGCAGCTTGAGCACAGTTTACAAG GGTCAATTTGAGGATGGCCACACTGTAGCCATAAAAAGATTGAATCTGCACCATTTCGCTGCAGATACTGACAAGATCTT CAAGAGAGAAGCCAGCACCTTGAGCCAGTTGAGACACAGGAATTTGGTTAAAGTAGTTGGGTATGCATGGGAGAGTGGGA AAATGAAGGCTTTAGCTCTAGAGTACATGGAAAATGGCAACTTGGATAGCATCATACATGACAAAGAAGTAGATCAGTCA AGGTGGACATTATCTGAAAGACTTCGAGTTTTCATTTCTATTGCTAATGGGTTGGAATATTTGCACTCCGGTTATGGTAC TCCCATTGTGCACTGTGATCTAAAGCCTTCTAATGTCCTTTTAGACACAGACTGGGAAGCTCATGTCAGTGATTTTGGTA CAGCTCGAATACTTGGTCTTCATCTACAGGAAGGTAGTACCCTTTCCTCAACAGCCGCTTTGCAAGGCACAGTTGGTTAT TTGGCACCAGAATTTGCTTACATAAGGAAAGTAACTACTAAAGCGGATGTGTTCAGCTTTGGAATCATAGTAATGGAGTT TCTAACAAGAAGAAGGCCTACAGGGCTCTCAGAAGAGGATGACGGCTTGCCAATCACTTTGCGTGAAGTAGTCGCAAGAG CCCTTGCAAATGGAACTGAACAGCTTGTTAATATTGTGGACCCTATGCTGACCTGCAATGTCACAGAATACCATGTTGAA GTCTTGACAGAGCTCATTAAGCTTTCATTGCTCTGCACCCTCCCTGATCCTGAAAGTCGACCTAATATGAATGAGGTTCT ATCTGCACTTATGAAGCTTCAAACAGAAAAATAG 

cDNA/mRNA sequence (Lj4g3v0281040.1) extracted from Lotus japonicus MG20 v3.0 cDNA.

GTTACAATGGGGTCATGAGCATTATCTATAAAGGCTTCATTTACCAAAGCTAATGTCAGCAAGCTGCAATTGAATTTTCT CTTAAATTCAACAGTGATGTTATCTCTAAAGTTTAGTTTGACTCTGGTCATAGTCTTTTCAATTGTAGCCTCAGTTTCAT GTGCTGAGAATGTTGAAACTGAAGCTTTGAAAGCTTTCAAGAAGTCCATCACAAATGACCCAAATGGAGTCCTTGCAGAT TGGGTTGACACCCACCATCACTGCAACTGGTCTGGGATTGCATGTGACTCTACAAATCATGTTGTTTCAATTACTCTGGC TAGTTTTCAGCTCCAAGGTGAGATTTCACCATTCCTTGGAAACATTTCTGGCCTTCAGCTTCTTGACTTAACTTCAAATT TGTTTACTGGGTTTATTCCCTCTGAGCTCAGTCTCTGCACTCAACTTTCTGAACTGGATCTTGTTGAAAATTCTCTCTCA GGACCAATCCCTCCTGCATTAGGAAACCTGAAAAATCTGCAGTATTTGGATTTAGGTAGTAACCTTTTGAATGGAACCCT CCCTGAGAGTTTATTCAACTGCACTTCTTTGTTGGGTATTGCTTTCAATTTCAACAACCTCACTGGGAAAATCCCATCAA ACATTGGGAATCTTATCAACATTATACAAATTGTAGGGTTTGGGAATGCTTTTGTTGGGTCTATACCTCATTCCATAGGT CATTTGGGAGCTTTGAAATCTCTTGATTTTAGCCAAAACCAGTTATCAGGTGTGATACCTCCAGAGATTGGAAAGCTGAC AAATTTAGAAAACCTACTACTGTTTCAAAATTCCTTGACTGGGAAAATCCCTTCTGAGATTTCTCAGTGTACCAATCTTA TATACCTTGAGTTATATGAAAATAAGTTCATTGGAAGCATTCCTCCTGAGCTAGGAAGTCTAGTCCAATTGCTGACTTTG AGGTTATTTAGCAATAACTTAAACTCCACCATTCCATCTTCCATATTTCGGTTGAAATCGCTAACGCACTTAGGACTCTC AGACAATAACTTAGAGGGAACAATCTCTTCTGAGATTGGATCTCTGAGTTCCTTACAAGTGCTAACCCTGCATTTGAACA AGTTTACTGGGAAAATCCCTTCATCAATAACAAACTTGAGAAACTTGACATCTCTGGCTATTAGTCAGAATTTCCTTTCA GGTGAACTCCCTCCAGACCTGGGAAAGCTTCACAATTTGAAGATTCTTGTCTTGAATAACAACATTCTACATGGACCCAT TCCCCCTAGCATTACCAATTGTACTGGCTTGGTGAATGTGAGTTTGTCTTTTAATGCTTTCACTGGGGGAATTCCTGAGG GCATGTCAAGGCTGCATAACCTCACTTTTCTGTCTCTTGCGTCAAACAAAATGAGTGGGGAAATCCCTGATGACCTCTTC AACTGCTCAAATCTTAGTACTCTAAGTCTAGCAGAAAACAACTTCAGCGGATTGATTAAACCTGATATCCAGAACCTGTT GAAACTCTCGCGTTTGCAACTACATACAAATTCTTTCACGGGACTGATCCCGCCGGAGATTGGAAACTTGAATCAACTCA TCACTTTGACCCTTTCTGAAAATAGATTTTCAGGTCGAATTCCACCAGAACTTTCCAAACTTTCTCCCCTTCAGGGACTC TCCCTCCATGAGAATTTATTAGAAGGCACAATACCTGATAAACTCTCTGATTTAAAAAGACTAACAACACTTTCATTGAA TAACAACAAGTTGGTTGGTCAAATACCAGATTCTATCTCAAGCCTTGAGATGCTTTCATTCTTAGACCTCCATGGAAACA AATTGAATGGATCCATTCCCAGAAGCATGGGGAAGCTTAATCATCTTTTAATGTTGGATCTCTCTCACAACGACCTCACG GGATCGATTCCGGGAGATGTCATTGCACACTTCAAAGACATGCAGATGTATCTTAACCTTTCAAACAACCACTTGGTGGG AAGTGTTCCACCAGAGCTGGGAATGTTGGTAATGACACAGGCCATTGATGTTTCAAACAACAATCTTTCGAGTTTCCTTC CTGAGACGCTTTCCGGGTGCAGAAATCTGTTCAGTCTTGATTTTTCAGGAAACAATATTTCAGGTCCTATTCCTGGAAAA GCTTTTAGTCAGATGGATTTGCTTCAAAGCTTAAACCTTTCAAGAAATCATTTAGAAGGTGAAATCCCTGACACCTTGGT AAAGCTTGAGCATCTTAGTTCCCTGGATCTTTCTCAGAACAAATTGAAGGGAACCATTCCTCAGGGCTTTGCCAATCTTT CTAACCTGCTGCATCTCAATCTTTCTTTCAATCAACTTGAAGGTCCTATACCTACAACAGGAATCTTTGCACATATCAAT GCATCTAGTATGATGGGAAACCAGGCTCTTTGTGGAGCGAAACTCCAACGGCCATGCCGAGAGAGTGGTCATACACTATC CAAGAAGGGCATAGCCATTATCGCTGCACTTGGATCTCTTGCTATAATTCTACTTCTATTGTTTGTGATTTTAATTCTGA ATCGACGCACCAGACTCAGAAATTCTAAACCAAGAGATGACAGTGTGAAATATGAACCAGGGTTTGGTTCAGCATTGGCT CTTAAAAGATTCAAGCCAGAGGAGTTTGAAAATGCCACTGGTTTTTTCAGTCCTGCCAATATCATTGGTGCTAGCAGCTT GAGCACAGTTTACAAGGGTCAATTTGAGGATGGCCACACTGTAGCCATAAAAAGATTGAATCTGCACCATTTCGCTGCAG ATACTGACAAGATCTTCAAGAGAGAAGCCAGCACCTTGAGCCAGTTGAGACACAGGAATTTGGTTAAAGTAGTTGGGTAT GCATGGGAGAGTGGGAAAATGAAGGCTTTAGCTCTAGAGTACATGGAAAATGGCAACTTGGATAGCATCATACATGACAA AGAAGTAGATCAGTCAAGGTGGACATTATCTGAAAGACTTCGAGTTTTCATTTCTATTGCTAATGGGTTGGAATATTTGC ACTCCGGTTATGGTACTCCCATTGTGCACTGTGATCTAAAGCCTTCTAATGTCCTTTTAGACACAGACTGGGAAGCTCAT GTCAGTGATTTTGGTACAGCTCGAATACTTGGTCTTCATCTACAGGAAGGTAGTACCCTTTCCTCAACAGCCGCTTTGCA AGGCACAGTTGGTTATTTGGCACCAGAATTTGCTTACATAAGGAAAGTAACTACTAAAGCGGATGTGTTCAGCTTTGGAA TCATAGTAATGGAGTTTCTAACAAGAAGAAGGCCTACAGGGCTCTCAGAAGAGGATGACGGCTTGCCAATCACTTTGCGT GAAGTAGTCGCAAGAGCCCTTGCAAATGGAACTGAACAGCTTGTTAATATTGTGGACCCTATGCTGACCTGCAATGTCAC AGAATACCATGTTGAAGTCTTGACAGAGCTCATTAAGCTTTCATTGCTCTGCACCCTCCCTGATCCTGAAAGTCGACCTA ATATGAATGAGGTTCTATCTGCACTTATGAAGCTTCAAACAGAAAAATAGTACTACTGTCTTGTTAAATGGCAAACACCT TCAGTCAATCCTTGGTGCTGCTTTTTCAGAAGATGAAACATTGAGTGTTTTCCAATTACTTCATTTTTAGTGTGTTTAAC AATGGCAAAGCTATCTGGTATCAATGTAAGTTTTACAATTATGATGAAAGGCATCCGATATTTTTTGTACTCGAGTCTGC AATTAGTAAGTGGAACTTTCGTACAATGACTAGTATTCTTTCACAACCTTATAGCATTGATAGACTTGCTGCAAACTCTT TTCTTTTCACTCTCCCTCCCCACTGT 

Protein sequence (Lj4g3v0281040.1) extracted from Lotus japonicus MG20 v3.0 Proteins.

MLSLKFSLTLVIVFSIVASVSCAENVETEALKAFKKSITNDPNGVLADWVDTHHHCNWSGIACDSTNHVVSITLASFQLQ GEISPFLGNISGLQLLDLTSNLFTGFIPSELSLCTQLSELDLVENSLSGPIPPALGNLKNLQYLDLGSNLLNGTLPESLF NCTSLLGIAFNFNNLTGKIPSNIGNLINIIQIVGFGNAFVGSIPHSIGHLGALKSLDFSQNQLSGVIPPEIGKLTNLENL LLFQNSLTGKIPSEISQCTNLIYLELYENKFIGSIPPELGSLVQLLTLRLFSNNLNSTIPSSIFRLKSLTHLGLSDNNLE GTISSEIGSLSSLQVLTLHLNKFTGKIPSSITNLRNLTSLAISQNFLSGELPPDLGKLHNLKILVLNNNILHGPIPPSIT NCTGLVNVSLSFNAFTGGIPEGMSRLHNLTFLSLASNKMSGEIPDDLFNCSNLSTLSLAENNFSGLIKPDIQNLLKLSRL QLHTNSFTGLIPPEIGNLNQLITLTLSENRFSGRIPPELSKLSPLQGLSLHENLLEGTIPDKLSDLKRLTTLSLNNNKLV GQIPDSISSLEMLSFLDLHGNKLNGSIPRSMGKLNHLLMLDLSHNDLTGSIPGDVIAHFKDMQMYLNLSNNHLVGSVPPE LGMLVMTQAIDVSNNNLSSFLPETLSGCRNLFSLDFSGNNISGPIPGKAFSQMDLLQSLNLSRNHLEGEIPDTLVKLEHL SSLDLSQNKLKGTIPQGFANLSNLLHLNLSFNQLEGPIPTTGIFAHINASSMMGNQALCGAKLQRPCRESGHTLSKKGIA IIAALGSLAIILLLLFVILILNRRTRLRNSKPRDDSVKYEPGFGSALALKRFKPEEFENATGFFSPANIIGASSLSTVYK GQFEDGHTVAIKRLNLHHFAADTDKIFKREASTLSQLRHRNLVKVVGYAWESGKMKALALEYMENGNLDSIIHDKEVDQS RWTLSERLRVFISIANGLEYLHSGYGTPIVHCDLKPSNVLLDTDWEAHVSDFGTARILGLHLQEGSTLSSTAALQGTVGY LAPEFAYIRKVTTKADVFSFGIIVMEFLTRRRPTGLSEEDDGLPITLREVVARALANGTEQLVNIVDPMLTCNVTEYHVE VLTELIKLSLLCTLPDPESRPNMNEVLSALMKLQTEK 

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Merging data from EBeye. Please wait…

Domains

Sorting

Prediction algorithm Identifier Start End Length E-value InterPro ID
SignalP 1 23 23
Phobius 1 22 22
Phobius 1 5 5
PANTHER 1 180 180 0
ProSiteProfiles 1 22 22 5
SignalP 1 23 23
PANTHER 1 180 180 0
SignalP 1 22 22
Phobius 6 17 12
Phobius 18 22 5
Phobius 23 797 775
Pfam 26 64 39 2.50E-10
Gene3D 49 421 373 5.30E-70
SUPERFAMILY 51 264 214 6.43E-40
SMART 138 162 25 0.96
SMART 138 161 24 70
SMART 210 239 30 89
SMART 210 234 25 18
PANTHER 212 310 99 0
PANTHER 212 310 99 0
SUPERFAMILY 215 612 398 7.85E-66
SMART 282 306 25 11
SMART 306 329 24 700
SMART 330 353 24 390
PANTHER 341 378 38 0
PANTHER 341 378 38 0
SMART 354 378 25 75
SMART 378 404 27 460
Pfam 380 402 23 1.2
SMART 426 455 30 240
SMART 426 450 25 9.3
Gene3D 442 783 342 1.50E-69
PANTHER 489 613 125 0
PANTHER 489 613 125 0
SMART 498 522 25 120
Pfam 525 583 59 3.00E-07
SMART 546 572 27 47
SMART 546 570 25 16
SUPERFAMILY 547 780 234 3.23E-49
SMART 594 618 25 39
PRINTS 597 610 14 2.60E-05
PANTHER 640 1150 511 0
PANTHER 640 1150 511 0
SMART 644 667 24 210
Pfam 649 706 58 5.60E-10
SMART 693 716 24 280
Pfam 712 754 43 3.20E-07
PRINTS 717 730 14 2.60E-05
SMART 717 743 27 47
SMART 717 740 24 13
SMART 741 766 26 14
Phobius 798 821 24
TMHMM 799 821 23
Phobius 822 1157 336
SUPERFAMILY 843 1151 309 2.87E-66
Gene3D 850 919 70 1.00E-12
SMART 864 1151 288 1.10E-29
ProSiteProfiles 864 1153 290 35.821
Pfam 868 1148 281 5.90E-40
CDD 870 1153 284 1.43E-83
Gene3D 920 1151 232 3.80E-42
ProSitePatterns 989 1001 13

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .

GO term Namespace Name Definition Relationships
Molecular function Protein kinase activity Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
Molecular function Protein binding Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
Molecular function ATP binding Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
Biological process Protein phosphorylation The process of introducing a phosphate group on to a protein.

Expression data

Expression pattern

Expression pattern of Lj4g3v0281040.1, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…

Co-expressed genes

A list of the top 25 highly co-expressed genes of Lj4g3v0281040.1, powered by CORGI.

Loading co-expressed genes from the dataset ljgea-geneid. This will take 20–30 seconds to construct.